KEGG   Desmodus rotundus (common vampire bat): 112304830
Entry
112304830         CDS       T05907                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04020  Calcium signaling pathway
dro04062  Chemokine signaling pathway
dro04064  NF-kappa B signaling pathway
dro04066  HIF-1 signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04150  mTOR signaling pathway
dro04270  Vascular smooth muscle contraction
dro04310  Wnt signaling pathway
dro04370  VEGF signaling pathway
dro04510  Focal adhesion
dro04540  Gap junction
dro04650  Natural killer cell mediated cytotoxicity
dro04662  B cell receptor signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04670  Leukocyte transendothelial migration
dro04713  Circadian entrainment
dro04720  Long-term potentiation
dro04723  Retrograde endocannabinoid signaling
dro04724  Glutamatergic synapse
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04727  GABAergic synapse
dro04728  Dopaminergic synapse
dro04730  Long-term depression
dro04750  Inflammatory mediator regulation of TRP channels
dro04911  Insulin secretion
dro04912  GnRH signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04929  GnRH secretion
dro04931  Insulin resistance
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro04961  Endocrine and other factor-regulated calcium reabsorption
dro04970  Salivary secretion
dro04971  Gastric acid secretion
dro04972  Pancreatic secretion
dro04973  Carbohydrate digestion and absorption
dro05017  Spinocerebellar ataxia
dro05031  Amphetamine addiction
dro05032  Morphine addiction
dro05140  Leishmaniasis
dro05143  African trypanosomiasis
dro05146  Amoebiasis
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05214  Glioma
dro05223  Non-small cell lung cancer
dro05225  Hepatocellular carcinoma
dro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112304830 (PRKCB)
   04012 ErbB signaling pathway
    112304830 (PRKCB)
   04014 Ras signaling pathway
    112304830 (PRKCB)
   04015 Rap1 signaling pathway
    112304830 (PRKCB)
   04310 Wnt signaling pathway
    112304830 (PRKCB)
   04370 VEGF signaling pathway
    112304830 (PRKCB)
   04064 NF-kappa B signaling pathway
    112304830 (PRKCB)
   04066 HIF-1 signaling pathway
    112304830 (PRKCB)
   04020 Calcium signaling pathway
    112304830 (PRKCB)
   04070 Phosphatidylinositol signaling system
    112304830 (PRKCB)
   04071 Sphingolipid signaling pathway
    112304830 (PRKCB)
   04150 mTOR signaling pathway
    112304830 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112304830 (PRKCB)
   04540 Gap junction
    112304830 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112304830 (PRKCB)
   04662 B cell receptor signaling pathway
    112304830 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    112304830 (PRKCB)
   04670 Leukocyte transendothelial migration
    112304830 (PRKCB)
   04062 Chemokine signaling pathway
    112304830 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    112304830 (PRKCB)
   04929 GnRH secretion
    112304830 (PRKCB)
   04912 GnRH signaling pathway
    112304830 (PRKCB)
   04921 Oxytocin signaling pathway
    112304830 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    112304830 (PRKCB)
   04918 Thyroid hormone synthesis
    112304830 (PRKCB)
   04919 Thyroid hormone signaling pathway
    112304830 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    112304830 (PRKCB)
   04916 Melanogenesis
    112304830 (PRKCB)
   04925 Aldosterone synthesis and secretion
    112304830 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112304830 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    112304830 (PRKCB)
   04971 Gastric acid secretion
    112304830 (PRKCB)
   04972 Pancreatic secretion
    112304830 (PRKCB)
   04973 Carbohydrate digestion and absorption
    112304830 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112304830 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    112304830 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    112304830 (PRKCB)
   04727 GABAergic synapse
    112304830 (PRKCB)
   04725 Cholinergic synapse
    112304830 (PRKCB)
   04728 Dopaminergic synapse
    112304830 (PRKCB)
   04726 Serotonergic synapse
    112304830 (PRKCB)
   04720 Long-term potentiation
    112304830 (PRKCB)
   04730 Long-term depression
    112304830 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    112304830 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112304830 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112304830 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112304830 (PRKCB)
   05206 MicroRNAs in cancer
    112304830 (PRKCB)
   05205 Proteoglycans in cancer
    112304830 (PRKCB)
   05231 Choline metabolism in cancer
    112304830 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112304830 (PRKCB)
   05214 Glioma
    112304830 (PRKCB)
   05223 Non-small cell lung cancer
    112304830 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    112304830 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    112304830 (PRKCB)
   05032 Morphine addiction
    112304830 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112304830 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112304830 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112304830 (PRKCB)
   05164 Influenza A
    112304830 (PRKCB)
   05161 Hepatitis B
    112304830 (PRKCB)
   05163 Human cytomegalovirus infection
    112304830 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112304830 (PRKCB)
   05140 Leishmaniasis
    112304830 (PRKCB)
   05143 African trypanosomiasis
    112304830 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112304830 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112304830 (PRKCB)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     112304830 (PRKCB)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   112304830 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 112304830
NCBI-ProteinID: XP_024416274
Position
Unknown
AA seq 673 aa
MADVFPANDSTAPQDVANRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIERDVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGGEGNEE
LRQKFERAKIGQGTKAPEEKTTNTIAKFDNNGNRDRMKLSDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKSCGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgcctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgagacagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggattccagtgccaagtctgctgttttgttgtgcacaagcgttgccatgaa
tttgtcactttctcctgcccaggcgctgacaagggtccagcctctgatgacccccggagc
aaacacaagtttaagatccacacctactccagccccacgttctgtgaccactgcgggtcg
ctgctgtatgggctcatccaccagggcatgaaatgtgacacctgcatgatgaatgtccac
aagcgctgtgtgatgaatgtccccagcctgtgcggcacagaccacacggaacgccgaggc
cgcatctacatccaggcgcacattgagagggatgtcctcatcgtggttgtaagagatgct
aaaaaccttgtacctatggaccccaatggcttgtcagatccctacgtgaaactgaaactc
attcctgaccccaaaagtgagagcaaacagaagaccaaaacaatcaagtgctccctcaac
cccgagtggaacgagacattcagattccagctgaaagaatcggacaaagacaggaggctg
tctgtggagatttgggattgggatctgaccagccggaacgacttcatgggatctctgtcg
tttgggatttctgaactgcagaaagctggtgtcgatggctggtttaagctgctgagccag
gaggagggagagtattttaatgtgcctgtgccaccggaaggaggcgagggcaatgaggag
ctgcggcagaaatttgagagagccaagatcggccagggaaccaaggctccggaagaaaag
acgaccaacaccatagccaaatttgacaacaatgggaacagagaccggatgaagctgagt
gattttaacttcctgatggtgcttgggaaaggcagctttggcaaggtcatgctgtcagag
cgcaaaggcacagatgagctttatgcagtgaagatcctgaaaaaagatgttgtcatccaa
gatgatgatgtggaatgcaccatggtggagaagcgtgtgctggccctgcctgggaagccg
ccattcctgacccagctgcactcctgcttccagaccatggaccgcctgtactttgtgatg
gaatacgtgaatggtggtgacctcatgtaccacatccagcaggttggccggtttaaggag
cctcatgctgtattttatgctgcagaaattgccattggcttgttcttcttacagagcaag
ggcatcatttaccgtgacctaaaacttgacaacgtgatgctggattctgagggccatatc
aagatcgctgattttggcatgtgtaaggagaacatctgggatggcgtgaccaccaagaca
ttctgcggcactccagactacatcgcccctgagataatcgcttatcagccctacgggaag
tcagtggactggtgggcatttggagtcctgctgtatgaaatgctagctggtcaggcaccc
tttgaaggggaggatgaggatgaactcttccagtccatcatggaacacaacgtggcttat
ccaaagtccatgtccaaggaagcagtggccatctgcaaagggctgatgaccaaacacccg
ggcaaacgtctgggttgtggacctgaaggtgaacgtgacatcaaagagcatgcattcttc
cggtacattgattgggagaaacttgaacgcaaagagatccagcctccgtataaaccgaaa
tcctgtgggcgaaatgctgaaaacttcgaccgatttttcacccgtcatccaccagtccta
acacctcccgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

DBGET integrated database retrieval system