KEGG   Desmodus rotundus (common vampire bat): 112304832
Entry
112304832         CDS       T05907                                 

Gene name
CD19
Definition
(RefSeq) B-lymphocyte antigen CD19
  KO
K06465  B-lymphocyte antigen CD19
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04640  Hematopoietic cell lineage
dro04662  B cell receptor signaling pathway
dro05169  Epstein-Barr virus infection
dro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112304832 (CD19)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112304832 (CD19)
   04662 B cell receptor signaling pathway
    112304832 (CD19)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    112304832 (CD19)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112304832 (CD19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dro04090]
    112304832 (CD19)
CD molecules [BR:dro04090]
 Proteins
  112304832 (CD19)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig RAP
Other DBs
NCBI-GeneID: 112304832
NCBI-ProteinID: XP_024416276
Position
Unknown
AA seq 559 aa
MPPPLLLFFLLFLTPMGVRPQKSQLVNAKEGGSAVLPCLKASSDGPPSPPDQLAWYRQCQ
SAPFLQLSGGLPGLGVLLLISNISDQMGGFYLCQQGPPSEQGWQPGWTVSVNGSGELFRW
NASNIDAPGCDLENRSSEDRRPSSDHLTSSQLYVWTNDHPEIWEMDPECGLPKGSQNQSL
DQNLMVKPGSTLCLPCGVPSASMARGPISWIYVHPKKPNISLLTVNLSEDASVRKTWVLD
SLRGGAVLWLPQATARDAGKYYCYHGNTTIEMQLKVTAQSAIRHWLLEAGGWRVPATTLL
YLIFCMGSLVGLLYLRRALVLRRKRKRMTDPTKRFFKVTPPPGSGAHNQYGNVLSLSTPT
TGTGRSLQWAAGLGAAGQSYRNPCSDVQEARAARSRSQTEAGPEEEGEAYEEPDSEEGSE
FYENDSNLGQEQLSQDGSGYENPDDDGALGPEDEDSFSNASESYENEDEELAQPVTKTKD
FLSPHGTAWDPSREATSLGSQSYEDMRGILYAAPQLRSLRAQPSPSHEEDADSYENMDNP
DGPEPAWGGGGHMGTWSTR
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgccacctcctctcctcctcttcttcctccttttccttactcccatgggagtcaggccc
cagaaatcacagctggtgaacgctaaagagggaggcagtgctgtgctgccgtgcctcaag
gcttcctcagacggtcctcccagtcctcccgatcagctggcctggtatcggcagtgccag
tcagcgccttttttacagctgagcggagggctgccgggcctgggcgtcctgctgctcatc
tccaacatctctgaccagatggggggcttctacctgtgccaacaggggccgccttctgag
cagggctggcagcctggctggacagtcagcgtgaacggcagcggggagctattccggtgg
aacgcttcaaacatagatgccccaggctgtgacctggagaacaggtcctcagaggaccgc
aggccctcttccgaccacctcaccagctcccagctgtatgtatggaccaatgaccaccct
gagatttgggagatggatcctgagtgtggactacctaagggcagccaaaaccagagcctg
gaccaaaacctcatggtgaaacctggttccactctctgtctgccctgtggggtgccttct
gcctccatggccaggggacccatctcctggatctacgtgcaccccaagaagcctaacatc
tcattactgactgtaaacctgagcgaggatgcttcagtgagaaagacgtgggtcttggac
tccctcaggggaggggctgttctgtggctgccccaggccacagctagagatgctggcaaa
tattattgttaccatggcaacactaccattgagatgcagctgaaggttactgcccagtca
gcaatacggcattggctgctggaggctggtggctggagagtccctgctacgactttactt
tatctgatattctgcatgggttccctcgtgggccttctttatcttcgaagagccctggtc
ctgaggaggaaaagaaagcgaatgaccgatcccaccaaaaggttcttcaaagtgacacct
ccccctggaagcggggcccacaaccagtacgggaatgtgctctccctttccacacccacc
actggcacgggacgctccctgcaatgggctgcaggcctgggggccgcaggccagtcctac
cgaaacccgtgcagcgatgtccaggaggctcgtgcagcgaggtcccggagccagacagaa
gctggcccagaagaagaaggggaggcctatgaggagccggacagtgaggagggctcggag
ttctacgagaatgactccaaccttgggcaggagcagctctcccaggatggcagcggctat
gagaaccctgatgacgacggggccttgggtcctgaggatgaagactccttctccaatgca
tctgagtcatatgagaacgaggatgaggagctggcccagccggtcaccaagacaaaagac
tttctgagcccccatgggacagcctgggaccccagccgggaggcaacatcccttgggtcc
cagtcctatgaggatatgagagggatcctgtatgcagccccccagctccgctcccttcgg
gcccagcctagtcccagtcatgaggaagatgcagactcttatgagaacatggataatcct
gatgggccagaaccagcatggggcggagggggccacatggggacctggagcacccggtga

DBGET integrated database retrieval system