KEGG   Desmodus rotundus (common vampire bat): 112305296
Entry
112305296         CDS       T05907                                 

Gene name
PRF1
Definition
(RefSeq) perforin-1
  KO
K07818  perforin 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04210  Apoptosis
dro04650  Natural killer cell mediated cytotoxicity
dro04940  Type I diabetes mellitus
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112305296 (PRF1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112305296 (PRF1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112305296 (PRF1)
   05330 Allograft rejection
    112305296 (PRF1)
   05332 Graft-versus-host disease
    112305296 (PRF1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112305296 (PRF1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112305296 (PRF1)
SSDB
Motif
Pfam: MACPF C2
Other DBs
NCBI-GeneID: 112305296
NCBI-ProteinID: XP_024416785
Position
Unknown
AA seq 554 aa
MATRVFLLGTLLLLLPTPAPAPCYTAARSECQRDRKFVPGSWLAGEGVDVTSLRRSGSFL
VDTQHFLRPDGTCTLCRNNLQNALQRLPLALTDWRAYSSACRRHVAKAQTSSIEDVAKDA
AASIHNDWRAGLEVNPKPSSSARVAVAGSHSKEANFAAQKSQRDKYSFSTDSVECRLYSS
HLVHSPPLHPDFRRALRDLPPHFSASTKPDYFRLISNYGTHFIRSMELGGRISAITALHT
CELALDGLTADGVGDCLSVEAEVSIGGRASSSAEVKACEEKKKQSKMTASFHQTYRERSV
EVEGGHHTSMPDLLFGNHAGPEQFTAWVTSLQDSPGLVDYTLEPLHVLLGKQDPQREALR
QAVSQYVIHRARWQNCSRPCPPGQRKSPHDPCQCVCHGSAVTSQGCCPRHRGLARLEVRD
FQATGLWGDVFTATDAYVKVFFGDQELRTGTVWNNNNPQWKTRLDFGDVLLTTGGPLRVQ
VWDADNGWDDDLLGTCDRTPQSGSQKVECALNHGRLKFFYDVKCLPHLTGGTCLDYAPQP
LLREPPGNRSGAVW
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggccacccgtgtgttcctcttgggcaccctgctcctgctgctgcccacacctgccccc
gccccctgctatactgccgcacgatccgagtgccagcgagatcgcaagttcgtgcccggc
tcatggctggcaggggagggcgttgatgtgaccagcctccgccgctcaggctccttcctg
gtggacacacagcacttcctacggcctgatggcacctgcaccctctgccgcaacaaccta
cagaatgccctgcagcgcctgcccctggcgctcaccgactggcgcgcctacagctcggcc
tgccggcgccatgtggccaaggcccagaccagctccatagaggatgtggccaaggatgca
gctgccagcatccacaatgactggcgggcaggactggaagtaaatcccaagcccagctcc
agtgctcgtgtagcagtggccggctcacattccaaggaggccaatttcgcagcccagaaa
agccaacgggacaagtacagcttcagcactgactcagtggagtgtcgcctctacagttct
cacctggtgcactctccaccactccaccctgacttcaggagggccctcagggacctgccc
ccccacttcagtgcctccaccaagcctgactacttcagactcatctccaactacggcacc
cacttcatccgctccatggagctgggtggcaggatctctgccatcaccgccctgcacacc
tgcgagctggccctggacgggctcacggccgacggggtgggggactgcctgtctgttgag
gccgaggtcagcataggcggccgcgccagctcctcagcggaagtcaaggcctgtgaagag
aagaagaagcagagcaagatgacagcctccttccaccagacctaccgggaacgcagtgtg
gaggttgaaggtggccaccacacctccatgcctgacttgttgttcgggaaccacgctggg
cccgagcaattcacagcctgggtcacctccctgcaggacagccccggcctggtggactac
accctggagcccctgcacgtgctcttggggaaacaggacccacagcgggaggcgctgcgt
caggctgtcagccagtatgtgatacacagggcccgctggcagaactgcagccggccctgc
cccccggggcagcggaagagcccccacgacccctgccagtgtgtgtgccacggctcggcg
gtcaccagccagggctgctgtccccggcacaggggcctggcccggctagaggttagggac
ttccaggcgacaggtctgtggggagacgtatttactgccacggacgcctatgtgaaggtt
ttctttggagaccaggagctgaggacaggcacagtgtggaacaataacaacccccagtgg
aagacacggctggactttggggacgtgctcctgaccacaggggggcccttaagggtgcag
gtctgggacgcagacaatggctgggacgatgaccttctcggcacctgcgaccggactcca
cagtctggctctcaaaaggtggagtgtgccctgaatcacggcaggctgaaattcttctac
gatgtcaaatgcctgcctcacctgacagggggcacctgcctcgattatgctccccaaccg
cttctgcgggagcctcctggaaaccggagtggagcggtatggtga

DBGET integrated database retrieval system