KEGG   Desmodus rotundus (common vampire bat): 112305970
Entry
112305970         CDS       T05907                                 

Gene name
ARNT2
Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor nuclear translocator 2
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:dro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112305970 (ARNT2)
   05202 Transcriptional misregulation in cancer
    112305970 (ARNT2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112305970 (ARNT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112305970 (ARNT2)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112305970 (ARNT2)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 PAS_9 HLH PAS_4 PAS_2
Other DBs
NCBI-GeneID: 112305970
NCBI-ProteinID: XP_024417536
Position
Unknown
AA seq 706 aa
MASDIPGSVSLPVAPMAASGQVRMAGVLPARGGKRRSGMDFDDEDGEGPSKFSRXNGVQV
EPRARNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPS
FLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDD
VEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDHL
PLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEEDADVGQGSKYCL
VAIGRLQVTSSPVCMDMSGVSAPTEFLSRHSADGTITFVDPRCISVIGYQPQDLLGKDIL
EFCHSEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWLLIRTSSFTFQNPYSDEIEYV
ICTNTNVKQLQQQQAELEVHQRDGLSSYDLAQVPVPSLPAGVHEAGKPVEKADAIFSQER
DPRFAEMFAGIGASEKKMMSSASATGTQQIYSQGSPFPAGHSGKAFSSSVVHVPGVNDIQ
SSSSAGQNLPQMSRQLNQSQVAWTGSRPPFPGQQMSSQSSKTQSSPFGIGTSHSYPADPA
SYSPLSSPATSSPSGNAYSSLASRTPGFAESGQSSGQFPGRPSEVWSQWQSQHHGQQSSE
QHAHQQPGQSEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggcttcggacatccccggctcagtgtcgctgcccgtggcgcccatggcagcctctggc
caggtgcggatggcgggggtcctgcccgcccgcggaggaaagcggcgttccggaatggac
ttcgatgatgaagacggggaaggtccgagcaaattttcaaggtgaaacggtgtccaggtg
gagcccagggcccggaacaagatgacccagtacatcacggagctgtctgacatggtgccc
acctgcagcgcactggcccgcaagcccgacaagctgaccatcctgcgcatggccgtgtcg
cacatgaagtccatgcggggcacaggcaacaagtccacggacggcgcctacaagccctca
ttcctcacagagcaggaactgaagcatctcatcctggaagcagccgacgggtttctgttt
gtcgtggcggccgagacagggcgagtgatctacgtgtccgactccgtcacccccgtgctg
aaccagccccagtcggagtggtttgggagcaccctctatgaacaggtgcaccccgacgac
gtggagaagctgagggagcagctgtgtacctcggagaactccatgacaggccggatcctg
gacctgaagacggggacggtcaagaaggaaggacaacagtcgtccatgaggatgtgcatg
ggttctcggaggtccttcatctgcaggatgaggtgtgggaatgctccgctggaccacctc
cctctcaacagaataaccaccatgaggaagcggttcaggaacggcctcggccctgtgaaa
gaaggggaagcccagtacgccgtggtccactgcacgggatacatcaaggcctggcccccc
gcaggaatgaccatccccgaggaggacgccgacgtgggacaaggcagcaaatactgcctc
gtggcgattgggaggctgcaggtgaccagctcccccgtgtgcatggacatgagcggggtg
tcggcgcccacagagttcctgtcccggcacagtgccgacgggaccatcacgttcgtggac
ccgaggtgcatcagtgtgatcggctaccagccccaggacctgctgggaaaggacatcttg
gagttctgccactcggaggatcagagccacctgcgcgagagctttcagcaggtggtcaag
ctgaagggccaggtgctgtcagtcatgtaccggttccgcaccaagaaccgcgagtggctg
ctcatccgcaccagcagcttcaccttccagaacccgtactcagacgagatcgagtacgtc
atctgcaccaacaccaacgtcaagcagctccagcagcagcaggccgagctggaggtgcac
cagagggacgggctgtcatcatacgacctagcacaggtccctgtccccagcctgccagcc
ggtgtgcacgaagccgggaagcctgtggagaaggcggatgcgatcttttcccaggagagg
gacccccgctttgctgagatgttcgcagggatcggagcatcggagaaaaagatgatgagc
tcagcctcagccacgggaacccagcagatctactctcagggaagcccgttccccgctgga
cactcgggcaaggcctttagctcttcagtggtgcacgtgcctggagtgaatgacatccag
tcgtcatcctcggcaggccagaacctgccccagatgtcccggcagctgaaccagagccag
gtggcgtggacgggcagtcggcccccctttcctgggcagcaaatgtcctctcagtccagc
aagacgcagtcctccccctttgggattggaacgagccatagctacccggccgaccctgcc
tcctacagcccgctgtccagccccgcgacctcctcgcccagcgggaacgcctactccagt
ctggccagcaggactccggggttcgctgaaagcgggcagagcagcgggcagttccccggg
cggccttcggaagtctggtcccagtggcagagccagcaccacgggcagcagagcagcgag
cagcacgcgcaccagcagcccgggcagagcgaagtgttccaggacatgctgcccatgccc
ggggacccgacccaggggacaggcaactacaacatcgaggacttcgccgacctgggcatg
ttcccgccgttttctgagtag

DBGET integrated database retrieval system