KEGG   Desmodus rotundus (common vampire bat): 112306573
Entry
112306573         CDS       T05907                                 

Gene name
VAV2
Definition
(RefSeq) guanine nucleotide exchange factor VAV2
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04015  Rap1 signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04510  Focal adhesion
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04670  Leukocyte transendothelial migration
dro04810  Regulation of actin cytoskeleton
dro05135  Yersinia infection
dro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112306573 (VAV2)
   04024 cAMP signaling pathway
    112306573 (VAV2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112306573 (VAV2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112306573 (VAV2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112306573 (VAV2)
   04660 T cell receptor signaling pathway
    112306573 (VAV2)
   04662 B cell receptor signaling pathway
    112306573 (VAV2)
   04664 Fc epsilon RI signaling pathway
    112306573 (VAV2)
   04666 Fc gamma R-mediated phagocytosis
    112306573 (VAV2)
   04670 Leukocyte transendothelial migration
    112306573 (VAV2)
   04062 Chemokine signaling pathway
    112306573 (VAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112306573 (VAV2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112306573 (VAV2)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH3_9 SH2 C1_1 PH CDC24 PH_10 SH2_2 Zn_ribbon_17
Other DBs
NCBI-GeneID: 112306573
NCBI-ProteinID: XP_024418313
Position
Unknown
AA seq 844 aa
MGLERLVVPWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHNV
AQNKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMKMGMTEDDKRNCCLLEIQETEAKYCRTLEDIEKNYMVPLRLVLSPGDVAAIFINLE
DLIKVHRSFLRAIDLSMMAGGGTLAKVFLEFKERLLIYGEYCSHMEHAQNTLNQLLASRE
DFRLKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPERQQLKEALEA
MQDLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRRGYSYELKEVIELLLHKVTDDPTNNKDLKKSHGKMWSYGFYLIHLQ
GKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMCTFDKTTSCKACRMFLR
GTFYQGYLCTKCGVGAHKECLEVTPPCKISSPADLDAPGAGPGPKMVAVQNYHGNPAPPG
KPVLTFQTGDVIELLRGDPESQWWEGRLVQTRKSGYFPSTSVKPCPVDGRPPIGRLPSRE
IDYSAYPWFAGNMERQQTDNLLKPHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEK
DSWIHITEAKKFESLLELVEYYQYHSLKESFKQLDTTLKYPYKSRERATSRASSRSPVCA
PRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWRGETNGRVGWFPSTYVEE
EGVQ
NT seq 2535 nt   +upstreamnt  +downstreamnt
atgggcctggagcgtctggtcgtgccatggctcatcgactgcaaggtcctgccgcccaac
caccgcgtcgtgtggccctcggccgtggtcttcgacctggcgcaggcgctgcgggacggc
gtgctgctgtgccagctgctgcacaacctctcccccggctccatcgacctgaaggacatc
aacttccggccgcagatgtcccagttcctgtgtttgaagaacatccgaaccttccttaaa
gtctgccacgataagtttggattacgaaacagtgagctgtttgacccctttgacctcttc
gacgtccgtgactttgggaaggtcatctctgcggtgtccaggctgtccctgcacaatgtg
gcccagaacaaagggatcaggccttttccctcagaggagacggcagagaacgatgacgat
gtgtaccgcagcctggaggagctggccgacgagcatgacctgggggaggacatctacgac
tgcgtcccgtgcgaggatgaaggcgacgacatctacgaggacatcatcaaggtggaggtg
cagcagcccatgaaaatgggcatgaccgaggatgacaagaggaactgctgcctgctggag
atccaggagacggaggccaagtactgccggacgctggaggacatcgagaagaactacatg
gtccccctgaggctggtgctgagcccgggggacgtggcggccatctttatcaacctggag
gacctcatcaaggtgcatcgcagcttcctgcgagccatcgacctgtccatgatggccggg
ggcggcactctcgccaaggtcttcctcgagttcaaggagaggctcctgatctacggcgag
tactgcagccacatggaacacgcccagaacacgctgaaccagctcctcgccagccgggag
gacttcagactgaaagtcgaggaatgcacgctgaaggtccaggacgggaagttcaagctg
caggacctgctggtggtgcccatgcagagggtgctcaagtaccacctcctcctaaaggaa
cttctgagccattccaccgaccggccggagaggcagcagctgaaggaagcactggaagcc
atgcaggacttggccatgtacataaatgaggtcaagcgggacaaagagaccctcaagaaa
atcagcgaattccagagctccatagaaaacctgcaagtgaagctggaggagtttgggagg
ccaaagatcgacggggagctgaaggtccggtccatagtcaaccacaccaagcaggacagg
tacttgttcctgttcgacaaggtggtcatcgtctgcaagaggcggggctacagctacgag
ctgaaggaggtcatcgagctgctgctccacaaggtgaccgacgaccccacgaacaacaag
gacctcaagaagtctcatgggaaaatgtggtcctacggcttctacctgatccacctgcaa
ggcaagcagggcttccagttcttctgcaagacggaggacatgaagcggaagtggatggag
cagttcgagatggccatgtcaaacatcaagccggacaaagccaacgccaaccaccacagc
ttccagatgtgcacgttcgacaagaccaccagctgcaaagcctgtaggatgttcctcagg
ggcaccttctaccagggatacctgtgcaccaagtgtggcgtcggggcgcacaaggagtgt
ctggaagtgacgcctccctgcaagatcagttcgcctgcagacctggatgcccctggagct
ggaccagggcccaagatggtggctgtgcagaattaccatggcaaccctgcaccccccggg
aagccggtgctgaccttccagacgggcgacgtgatcgagctgctaagaggcgaccccgag
tctcagtggtgggaggggcggctggtgcaaaccaggaagtcaggctacttccccagcaca
tctgtgaagccctgccctgtggatggaaggccacccatcggccggctgccgtccagggag
attgactacagtgcgtacccctggtttgcaggcaacatggagaggcagcagacggacaac
ctgctcaagccccacgccagcgggacctacctgatcagggagcggccggccgaggcggag
cgcttcgccataagcatcaagttcaacgatgaggtgaagcacatcaaggtggtggagaaa
gacagctggatccacatcacagaagcgaagaaattcgaaagcctcttggagttggtggag
tattaccagtaccactctctcaaggagagcttcaagcagctggacaccacgctcaagtac
ccctacaagtcccgggaacgcgcgacttccagggcctccagccgttccccagtgtgtgcg
ccccgcgtcatcggcacagccgtggccaggtacaactttgccgcccgggacatgcgggag
ctctcgctgcgggaaggcgacgtggtgaagatctacagccgcattggcggggaccagggc
tggtggcgaggcgagaccaacggccgggtcggctggtttccctcaacctacgttgaggag
gagggtgtccagtga

KEGG   Desmodus rotundus (common vampire bat): 112312402
Entry
112312402         CDS       T05907                                 

Gene name
VAV1
Definition
(RefSeq) proto-oncogene vav
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04015  Rap1 signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04510  Focal adhesion
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04670  Leukocyte transendothelial migration
dro04810  Regulation of actin cytoskeleton
dro05135  Yersinia infection
dro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112312402 (VAV1)
   04024 cAMP signaling pathway
    112312402 (VAV1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112312402 (VAV1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112312402 (VAV1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112312402 (VAV1)
   04660 T cell receptor signaling pathway
    112312402 (VAV1)
   04662 B cell receptor signaling pathway
    112312402 (VAV1)
   04664 Fc epsilon RI signaling pathway
    112312402 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    112312402 (VAV1)
   04670 Leukocyte transendothelial migration
    112312402 (VAV1)
   04062 Chemokine signaling pathway
    112312402 (VAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112312402 (VAV1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112312402 (VAV1)
SSDB
Motif
Pfam: RhoGEF CAMSAP_CH CH C1_1 PH SH3_2 SH3_1 CDC24 SH3_9 LZ3wCH C1_2 PH_16 PH_10
Other DBs
NCBI-GeneID: 112312402
NCBI-ProteinID: XP_024424627
Position
Unknown
AA seq 671 aa
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGITPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVPMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPDDIEIIFINI
EDLLRVHTHFLKEMKEALGPTSAPTLYQVFIKYKERFLVYGRYCSQVESASKHLDRVASA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDVSLAHYGRPKIDGELKITTAERRSKM
DRYAFLLDKALLICKRRGDSYELKDFVNLHSFQVRDDSSGDRDNKKWTHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCYRCRAPAHKECLGRVPPCGRHGQDFSGTMKKDRLHRRPQDKKRNELGLPKMEVC
QEYYGIPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTATNEVGWFPCNRVKPYVH
GPPQDLSIHLW
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggagctgtggcgacagtgtacccactggttgatccagtgccgggtactgccgcccagc
caccgcgtgacctgggacggggcccaggtgtgcgagctggctcaggcccttcgggatggg
gtccttctctgccagctgcttaacaacctgttgccccacgccatcaacttacgcgaggtc
aacctgcgcccccagatgtcccagttcctgtgccttaagaacatccgtaccttcttgtct
acctgttgtgagaagtttggccttaagaggagtgagctctttgaggcctttgacctgttc
gatgtgcaggattttgggaaggtcatctacaccctgtctgccctgtcctggaccccgatt
gcacagaacaaggggatcacgcccttccccactgaggaggagagtgtgggggatgaagat
atctacagtggcctgtccgaccagattgatgacacagtggaggaggatgaggacctgtat
gactgtgtggagaacgaggaggcggagggcgacgagatctacgaggacctcatgcgctcg
gagcccgtgcccatgccgcccaagatgacagagtatgacaagcggtgctgctgcctgcga
gagatccagcagacggaggagaagtacacggacacgctgggctccatccaacagcacttc
atgaagcccctgcaacggttcctcaaacccgacgacatagagatcatcttcataaacatc
gaggacctgcttcgtgtgcacacccacttcctgaaggagatgaaggaagccctgggcccc
accagtgcaccaaccctctaccaggtcttcatcaaatacaaggagaggttcctcgtctac
ggccgctactgcagccaggtggagtcagccagcaagcacctggaccgtgtggccagcgcc
cgggaggatgtgcaaatgaagctagaggaatgttctcagcgtgcaaacaatgggaggttc
accttgcgggacctgctgatggtgccgatgcagcgggtgctcaagtaccaccttcttctc
caggagctggtgaaacacacgcaggacgcgatggagaaggagaacctacgactggccctg
gatgcaatgagggacctggcacagtgcgtgaacgaggtcaagagggacaatgagaccctg
cggcagatcaccaacttccagctgtctattgagaacctggacgtgtctctggcccactat
ggccggcccaagatcgatggggaactgaagatcaccactgcggagcgccgctccaagatg
gacaggtacgccttcctgctggacaaagctctgctcatctgtaagcgccgaggggactcc
tacgaactcaaggactttgtgaacctgcacagcttccaggttcgagatgactcttctgga
gaccgtgacaacaagaagtggactcacatgtttctcctgattgaggaccaaggtgctcag
ggctatgagctgttcttcaagacgcgagaactgaagaagaagtggatggagcagttcgag
atggccatctccaacatctaccctgagaatgccacagccaatgggcatgacttccagatg
ttctcctttgaggagactacgtcctgcaaggcttgccagatgctgctgagaggaactttc
tatcagggctaccgttgttaccggtgtcgggcgcctgcacacaaagagtgtctggggaga
gtccctccctgtggccgccatgggcaagatttttctggaactatgaagaaggataggcta
catcgccggcctcaggacaaaaagaggaatgagctggggctgcccaagatggaggtttgc
caggagtactatgggattcctcctcccccgggagccattggcccttttctacggctcaac
cccggagacatcgtggagctcaccaaggctgaggcggaacagaactggtgggagggccgg
aatacagctaccaatgaagttggctggtttccctgtaacagggtcaagccctacgtgcat
ggccctcctcaggacctgtccattcatctctggtga

KEGG   Desmodus rotundus (common vampire bat): 112313799
Entry
112313799         CDS       T05907                                 

Gene name
VAV3
Definition
(RefSeq) guanine nucleotide exchange factor VAV3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04015  Rap1 signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04510  Focal adhesion
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04670  Leukocyte transendothelial migration
dro04810  Regulation of actin cytoskeleton
dro05135  Yersinia infection
dro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112313799 (VAV3)
   04024 cAMP signaling pathway
    112313799 (VAV3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112313799 (VAV3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112313799 (VAV3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112313799 (VAV3)
   04660 T cell receptor signaling pathway
    112313799 (VAV3)
   04662 B cell receptor signaling pathway
    112313799 (VAV3)
   04664 Fc epsilon RI signaling pathway
    112313799 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    112313799 (VAV3)
   04670 Leukocyte transendothelial migration
    112313799 (VAV3)
   04062 Chemokine signaling pathway
    112313799 (VAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112313799 (VAV3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112313799 (VAV3)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH3_9 SH2 C1_1 PH CDC24 Filamin PH_16 LZ3wCH PH_10 Prok-RING_1
Other DBs
NCBI-GeneID: 112313799
NCBI-ProteinID: XP_024426195
Position
Unknown
AA seq 847 aa
MEPWRQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRARSINLKEI
NLRPQMSQFLCLKNIRTFLAACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEEIVNDEDIYKALPDLIDETHVEDEEGFYDCVYGEDEGGEVYEDLMKAE
EAHQPKSPENDIRSCCLTEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKVHRNLMQEIHDSIVNKNDQNLYQIFINYKERLVIYGQYCSAVELAISSLDNIAKMKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPVEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHAKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDHADSNCHEFKMHTFTRVTSCKACHMLLRGTFYQ
GYLCVKCGARAHKECLGRVDNCGRVNSAEPGMLKAPEKRTNGLRRTSRQVDPGLPKMQVI
RNYAGTPPPTLHEGPPLHIQAGDTVELLRGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
IVARDGLFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRA
GNSLLSPKVLGIATARYDFCARDMRELSLLKGDVVKIYTKMSGNGWWRGEVNGKVGWFPS
TYVEMDE
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggagccgtggagacagtgcgcccagtggctcatccactgtaaggtgctgcccgctaac
caccgggtgacctgggactcggcgcaggtgttcgacctggcgcagaccctccgcgatgga
gtccttctctgccagctgctcaacaacctccgggcgcgctccatcaacctgaaggagatc
aacctgcggccgcagatgtcccagttcctctgtttgaagaacataaggacatttctggcg
gcctgttgcgagacctttggaatgagaaagagcgaactcttcgaggcgttcgacctgttt
gatgttcgtgactttggaaaggtgatagaaacattatcgcgactttctcgaacaccgata
gcattggccacaggaatcaggcccttcccgacggaggagatcgtcaacgatgaggacatc
tacaaagccctgcctgacttaatcgacgaaacccacgtggaggatgaagaaggtttctac
gactgcgtttacggggaggatgaaggtggcgaagtctacgaggacttgatgaaagccgag
gaagcgcatcagcctaaatctccagaaaatgacatacgaagttgctgcctaacagaaatc
aagcagacagaagaaaaatacacagaaacactggagtcaatagaaaaatatttcatggcc
ccgctgaaacggttcctgacggcagcagaattcgattccgtcttcatcaacattcctgaa
cttgtaaaagtgcatcggaacttaatgcaagaaattcatgattccattgtaaataaaaat
gaccagaatttgtatcaaattttcattaactacaaggaaaggctggttatttatgggcag
tactgcagcgcggtggagttggccatctcgagtttagacaacattgcgaagatgaaagaa
gacgtcaaactgaagctggaggaatgttccaagcgagccaataatgggaagttcactctt
cgggatttgcttgtggtcccgatgcagcgcgtcttaaagtatcaccttctccttcaggag
ctggtcaagcacaccaccgaccctgtcgagaaggcaaatctgaaactggccctcgacgct
atgaaggacttggcacaatatgtgaatgaagtgaagagagataatgagacccttcgtgaa
attaagcagtttcagctctctatagaaaatctgaaccaaccagttctgcttttcggacgg
ccgcagggcgatggggagattcggataaccacgttagacaagcacgccaagcaggaaagg
cacatcttcctgtttgacctggcagtcattgtctgcaaaaggaaaggcgacaactatgaa
atgaaggaaataatagatctccagcagtacaaaatcgccaacaatcctacgaccgataaa
gaaaacaaaaagtggtcttatggcttctacctcatccatacccaaggacaaaatgggtta
gaattttattgcaaaacaaaagatttaaagaaaaaatggctggaacagtttgaaatggct
ttatctaacatacgaccggaccatgccgactccaactgccacgagtttaagatgcacacc
tttacccgggtgacctcctgcaaggcctgccacatgctcctcaggggcacattttatcaa
ggctacctgtgtgttaagtgtggcgcgagggcacacaaggagtgtttgggaagagtagac
aactgtggcagagttaattctgctgaaccggggatgctcaaagcgccggagaaacggacc
aatggacttcgaagaacctcccgacaggtggatccaggtttaccaaagatgcaggtcatt
aggaactatgctgggacgccgccccccactcttcatgaagggcccccgttgcacatccag
gccggggacacagttgagcttctgaggggagacgcacacagtctgttttggcagggtaga
aacttagcatctggagaggtgggattctttccaagtgatgccgtcaagccttgcccatgc
gtgcccaaaccagtagattattcttgccagccatggtacgccggagctatggagagattg
caggcagagaccgaacttattaatagggtcaacagcacttacctggtgaggcaccggacc
aaagagtcaggagaatatgcgattagcattaagtacaataatgaagcaaagcacatcaag
attgtagccagagatggcttatttcacattgcagaaaatagaaaatttaaaagtttaatg
gagcttgtggagtattacaagcatcattccctcaaagaagggttcagaaccttagataca
actctccagtttccatacaaggagccagaacattcagcaggacagaggggcaacagagcg
ggcaacagcttgctgagtccgaaagtgctgggcatcgccaccgcacgctatgacttctgc
gctcgggatatgcgcgagctgtccttgctgaaaggggacgtggtgaagatctacacgaag
atgagcgggaacggctggtggagaggggaagtgaatggcaaggtgggctggttcccatcc
acgtatgtggaaatggacgaatag

DBGET integrated database retrieval system