KEGG   Desmodus rotundus (common vampire bat): 112307069
Entry
112307069         CDS       T05907                                 

Gene name
BLNK
Definition
(RefSeq) B-cell linker protein
  KO
K07371  B-cell linker protein
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04064  NF-kappa B signaling pathway
dro04380  Osteoclast differentiation
dro04662  B cell receptor signaling pathway
dro05169  Epstein-Barr virus infection
dro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112307069 (BLNK)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112307069 (BLNK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112307069 (BLNK)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    112307069 (BLNK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112307069 (BLNK)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 112307069
NCBI-ProteinID: XP_024418944
Position
Unknown
AA seq 456 aa
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADE
EEQWSDDFDSDYENPDEHSDSEMYVLPAEEMGDDSYEPPPVEQETRTVHPALPFARGEYI
DNRSSQRQSPPISQTLPSKPTWPSAKARLTSTLPAPTSLQKPQVPPRPKDLEDEADYVVP
VEDEDENYIHPTESSSPPSEKAPMVNRSTKPNNTSKPAPPPVTASGRNSGAWDCKSSLPA
VPSPLPRAGKKPATPLKTMPLASQQNASSVCEEKPIPAERHRGSSHRQEAVPSPAFPLAQ
KQVHQKPVPLPRFPEGGSPTVDVPLPSFSSNSSASEQEADVHCKPWYAGACDRKSAEEAL
YRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNVPVRFIEATKQYALGRKKNGEEYFG
SVAEIIKNHQHSPLVLIDSQNNTKDSTRLKYAVKVS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggacaagcttaataaaataactgtccctgccagtcagaagttgagacagcttcaaaag
atggtccatgatattaagaacaatgaaggtggaataatgaacaaaatcaaaaagctgaaa
gtcaaagcgcctccgagtgttcctcgaagggactatgcctctgagagccctgctgacgaa
gaggagcagtggtcagatgactttgacagcgactatgaaaacccagacgagcactcggac
tcggagatgtacgtgctgcctgccgaggaaatgggggatgacagttacgagccgccaccc
gtggagcaagagacacggacagttcacccagctctgcccttcgccaggggcgagtacata
gacaatcgatcaagccagaggcagtctccacccatcagccagacccttcccagtaagccc
acctggccttctgctaaggccaggctgacctccactctgccagctccaacttctctgcag
aaacctcaagtcccaccgaggcccaaggaccttgaggatgaggctgattatgtggtccct
gtagaagatgaagatgaaaactatattcatcccacagaaagcagttcacccccatctgaa
aaagctcccatggtgaatagatcaaccaagccaaacaacacttccaagccagcccctcct
ccagtgacagcttcaggtcgaaacagcggggcctgggactgtaagtcatctttacctgct
gtgccatccccactgcccagggccgggaaaaagccagctacaccactgaagacaatgcca
cttgcctctcaacagaatgcctcaagtgtttgcgaagaaaagcctatacctgctgaacgc
caccgaggatctagtcacagacaagaagctgtgccatcaccagcatttcctcttgcccag
aaacaagtccatcaaaaacccgtacctctgccaaggtttccagaagggggcagcccaact
gtggatgttccattacccagcttttcgtctaattccagtgcgtcagaacaggaagctgat
gttcactgtaagccatggtatgctggtgcctgtgaccgaaagtctgctgaagaagcatta
tacagatcaaacaaggatggatcattccttattcggaaaagctctggccatgattccaaa
cagccatatacattagttgtattttttaataagcgagtttataatgtccctgtgcgattt
attgaagcaacaaaacagtatgctttgggcagaaagaaaaatggtgaagagtactttgga
agtgttgctgaaattatcaagaatcatcaacatagtcccctggttcttatcgacagtcag
aataacacaaaggattccacaagactgaaatatgcagttaaagtttcataa

DBGET integrated database retrieval system