KEGG   Desmodus rotundus (common vampire bat): 112307095
Entry
112307095         CDS       T05907                                 

Gene name
PIK3AP1
Definition
(RefSeq) phosphoinositide 3-kinase adapter protein 1
  KO
K12230  phosphoinositide 3-kinase adapter protein 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112307095 (PIK3AP1)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112307095 (PIK3AP1)
SSDB
Motif
Pfam: DBB TIR_3
Other DBs
NCBI-GeneID: 112307095
NCBI-ProteinID: XP_024418968
Position
Unknown
AA seq 804 aa
MAASGVFRGCDILLFYSSDAEEWCQYLQDLFLSSRQVRSQKTLTYRLGPETSFSAEDLTF
FLSPRCIVVLLSAELVQCLGQPALLPLLQRAFHPPHRMVRLLCGVRDSKEFLDFFPDWAH
WQEFTCDDEPETYVAVVKKAISEDSGCDSVTDTETEDEKVLPYSKQQSLPLETSPGNLMV
VQPDRIRCGVETTVYVIVRCKLDERVTTEAEFFPEDSPSIRVEAKLENEYTVSVKAPNLS
SGNVFLKIYSGDLVVCETTVSYYTDMEEIGNLLSSAANPVEFMCQAFKIVPYNTETLDKL
LTESLKNNIPASGLHLFGVNQLEEEDMMTNQRNEELPTLLHFAAKYGLKNLTALLLTCPG
ALQAYSVANKHGHYPNTIAEKHGFRDLRQFIDEYVETVDMLKSHIKEELMQGEEADAVYE
SMAHLSTDLLMKCSLNPGCDEDLYESMAAFVPAATEDLYVEMLQASTSNPISGQGFAQAT
KDSMIRKFLEGNNVGMASLDRELYHHGPEDVYHTVDDDEAFSMDPANRPPVPVPRPEASA
SGAHHLPDNEPYISKVFAEKSQERPGNFYVSSESIRKEPPVRPWRDRPQSSIYDPFAGMK
TPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKRRSESFRFQQENLKRLRDSITRRQ
REKQKSGKQTALEITVPIRHSQHLPGKVEFGVYESGPRKSVFPPRTELRRGDWKTDSTSS
TASSTSNRSSTRSLLSVSSGMEGDNEDNEVPEVTRSRSPAPPQVEAAPPLPIERPPRVPP
RAASQRPPTRETFPPPPPVPRRGR
NT seq 2415 nt   +upstreamnt  +downstreamnt
atggcagcctcaggggtgttccgagggtgtgacatcctcctcttctatagctcggatgct
gaggaatggtgccagtatctccaggaccttttcctgtccagtcggcaggtccgcagccag
aagacgctgacttacaggctgggtcctgagacctccttctcagccgaggacttgaccttc
tttctcagcccgcgctgcatcgtggtgctgctgtccgcagagctagtgcagtgcttaggc
cagccggccctgctgcccctgctgcagagagccttccaccctccgcaccgcatggtccgg
ctgctctgcggggtgcgggacagcaaggagttcctggacttctttccagactgggcacac
tggcaggagttcacctgtgacgacgagcctgagacttatgtggcagttgtgaagaaggcc
atttctgaagattctggctgcgactcggtcacggacactgagactgaggacgagaaggtc
ctgccctactcgaagcagcagagcctgccactggagacttcacctgggaacctgatggtg
gtgcagccagaccgcattcgctgtggggtagaaaccacggtctacgtcattgtaagatgt
aagctggatgagagagtgacgacggaagcagagttttttccagaggattctccctcgata
agggtggaagccaagctggagaatgagtacaccgtgtccgtgaaggctcccaacctttcc
tccgggaatgtctttctgaaaatatattccggggatttagtggtgtgtgaaaccactgtg
agctactacaccgacatggaagaaatcgggaatctattgtccagtgccgcgaatcctgtg
gagttcatgtgtcaggcctttaaaattgtgccctacaacacagaaacccttgataaactg
ctgactgagtccctgaagaacaacatccctgcgagcggactgcacctcttcggagtcaac
cagctggaagaggaagacatgatgacaaatcagaggaatgaagagctgcccaccttgttg
cattttgctgcgaagtatggactgaagaacctcactgccttgttgctcacctgcccggga
gccctacaagcatacagtgtggccaacaagcatggccactaccccaacaccatcgctgag
aagcatggcttcagggacctgcggcagttcatcgatgaatacgtggaaactgtggacatg
ctgaagagccacattaaagaggaactgatgcaaggggaggaggccgacgccgtgtatgag
tccatggcccacctttccacagacctgctcatgaagtgctccctcaaccccggctgcgac
gaggatctgtacgagtccatggcggcctttgtcccagctgccactgaagatctctatgtt
gaaatgcttcaggccagcacatctaacccaatctctggacagggtttcgcccaggccact
aaggactctatgatccgcaagtttttagaaggcaacaacgtgggaatggccagtttggac
agggagctgtaccatcatggtccagaagatgtttatcacacagtggatgatgacgaggcc
ttttccatggacccggccaataggccccccgtcccagtgcccaggccagaggccagtgct
tctggtgctcaccatctgcccgacaacgaaccgtacatttctaaagtttttgcagaaaaa
agccaagagcgacctgggaatttctatgtttcctctgagagcatcaggaaagagcctccc
gtcagaccgtggagagacaggccccagtcaagtatatacgaccctttcgctgggatgaaa
acgccaggccagcggcagcttattactctccaggagcaggtgaagctgggcattgtcaac
gtggacgaagctgtgctccacttcaaagagtggcagctcaaccagaagaggcggtctgaa
tcctttcgcttccagcaggaaaatcttaagcggctaagagatagcattacccgaagacag
agagagaagcaaaaatcaggaaagcagacagccttggagatcaccgtgccaattcgtcac
tcacagcacctgcccgggaaagtggagtttggagtctatgagagtggccccaggaaaagc
gtcttccccccaaggaccgagctaagacgaggagactggaagacagacagcacctccagc
acagcaagcagcacgagtaaccggtccagcacccggagcctcctcagtgtgagcagcggg
atggagggggacaatgaggataacgaagtccctgaggttacccgaagtcggagtccagcc
cccccacaagtggaggctgcacccccactgcccatcgagaggccccccagggtgcctccc
cgagctgcctcacagaggcctccgaccagggagaccttccctcctcctccacctgttcca
cgcaggggtcgttga

DBGET integrated database retrieval system