KEGG   Desmodus rotundus (common vampire bat): 112307282
Entry
112307282         CDS       T05907                                 

Gene name
SYK
Definition
(RefSeq) tyrosine-protein kinase SYK
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04064  NF-kappa B signaling pathway
dro04072  Phospholipase D signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04380  Osteoclast differentiation
dro04611  Platelet activation
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro05152  Tuberculosis
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112307282 (SYK)
   04072 Phospholipase D signaling pathway
    112307282 (SYK)
   04151 PI3K-Akt signaling pathway
    112307282 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112307282 (SYK)
   04625 C-type lectin receptor signaling pathway
    112307282 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    112307282 (SYK)
   04662 B cell receptor signaling pathway
    112307282 (SYK)
   04664 Fc epsilon RI signaling pathway
    112307282 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    112307282 (SYK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112307282 (SYK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112307282 (SYK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112307282 (SYK)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112307282 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112307282 (SYK)
   05169 Epstein-Barr virus infection
    112307282 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112307282 (SYK)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112307282 (SYK)
Protein kinases [BR:dro01001]
 Non-receptor tyrosine kinases
  SYK family
   112307282 (SYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 Kdo
Other DBs
NCBI-GeneID: 112307282
NCBI-ProteinID: XP_024419138
Position
Unknown
AA seq 632 aa
MASGVADHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHY
TIERELNGTYAIAGGRAHASPAELCHYHSQESDGLICLLKKPFHRPPGVQPKTGPFEDLK
ENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRDESEQTVLI
GSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPDGKKFDTLWQLVEHY
SYKPDGLLRVLTIPCQKLGEQPGNINFVSRPQLPSAHPATLSVGGIISRIKSYSFPKPGH
RKAASSQGNRPESSVTFNPYEPDGGHWTAERESQREALPMDTEVYESPYADPEEIRPKEV
YLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANV
MQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMK
YLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPEC
INYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPPGCPREMYD
LMNLCWTYDVESRPGFAAVELRLRNYYYDVVN
NT seq 1899 nt   +upstreamnt  +downstreamnt
atggcctcaggtgtggctgaccacctgcccttcttctttggtaacatcacccgggaggag
gctgaggactacctggtccagggtggcatgagtgacgggctctacctgctgcgccagagc
cgcaattacctgggtggcttcgccctgtcagtggcacatgggcgcaaagcacaccactac
accattgagcgggagctgaatgggacctatgccatcgcaggtggcagggcccatgctagc
cctgctgagctctgccactaccactcccaagagtcagatggcctcatctgcctcctcaag
aagcccttccaccggccacctggggtgcagcccaagactggacccttcgaggacctgaag
gagaaccttatccgggagtatgtgaagcagacctggaacctgcagggccaagctctggaa
caggccattatcagccagaagcctcagctggagaagctgatcgccaccacagcccatgag
aaaatgccctggttccacggaaaaatctctcgggatgaatctgagcaaactgtcctgata
ggatcgaagacaaatggaaaatttttgatcagggccagggacaacaatgggtcctatgcc
ctgtgcctgctacatgagggcaaagtgctgcactaccgcatcgataaggacaagacgggg
aagctctccatcccagatggcaagaagtttgacacactctggcagctagtcgaacattat
tcttataaaccagatggtttgttaagagttcttacaattccatgtcaaaaacttggcgag
caaccgggaaatattaattttgtaagtcgtccacaacttccaagtgcccatccggcgact
ttgtcagtgggtggaatcatctcaagaatcaaatcatactccttcccaaagcctggccac
agaaaggccgcctcgtctcaggggaaccggccagagagctccgtgacattcaacccctat
gagccagatggagggcactggactgcagaaagagaatcccagagagaagccttgcccatg
gacacagaagtatatgaaagcccctatgcagaccccgaggagatcaggcccaaggaggtc
tacctagaccggaagctgctaaccctggaggacaaagaactgggctctggtaactttggc
accgtgaagaagggctactatcagatgaaaaaagttgtgaaaacagtagctgtgaaaatc
ctaaaaaatgaggccaatgacccagctctgaaggatgagctgttagcagaagccaatgtc
atgcagcagctagacaacccttacattgtgcgaatgatcgggatttgtgaagccgagtcc
tggatgctggttatggagatggcagaactcggtccactcaataaatatttacagcagaac
aggcatgtcaaggataagaacatcatagagctggttcaccaggtttctatgggaatgaaa
tatttggaggagagcaatttcgtgcatagagatctggctgcaagaaacgtattgctggtt
actcaacattatgccaagatcagtgattttggactttccaaagcacttcgtgctgatgaa
aactactacaaggcccagacccatgggaagtggcccgtgaagtggtacgctcctgagtgc
atcaactactacaagttctccagcaagagtgacgtctggagcttcggggtgttaatgtgg
gaagcattctcctatgggcagaagccatatcgggggatgaaaggaagtgaagtttccgct
atgctggagaaaggagagaggatggggtgccctccagggtgtccgagagagatgtatgat
ctgatgaacctgtgctggacatatgacgtggagagcaggcctggatttgcagcggtggaa
ctgcggctgcgcaattactactatgacgtggtgaactaa

DBGET integrated database retrieval system