KEGG   Desmodus rotundus (common vampire bat): 112307303
Entry
112307303         CDS       T05907                                 

Gene name
CD40LG
Definition
(RefSeq) CD40 ligand isoform X1
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04064  NF-kappa B signaling pathway
dro04514  Cell adhesion molecules
dro04660  T cell receptor signaling pathway
dro04672  Intestinal immune network for IgA production
dro05144  Malaria
dro05145  Toxoplasmosis
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05322  Systemic lupus erythematosus
dro05330  Allograft rejection
dro05340  Primary immunodeficiency
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112307303 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112307303 (CD40LG)
   04514 Cell adhesion molecules
    112307303 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    112307303 (CD40LG)
   04672 Intestinal immune network for IgA production
    112307303 (CD40LG)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    112307303 (CD40LG)
   05322 Systemic lupus erythematosus
    112307303 (CD40LG)
   05320 Autoimmune thyroid disease
    112307303 (CD40LG)
   05330 Allograft rejection
    112307303 (CD40LG)
   05340 Primary immunodeficiency
    112307303 (CD40LG)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112307303 (CD40LG)
  09174 Infectious disease: parasitic
   05144 Malaria
    112307303 (CD40LG)
   05145 Toxoplasmosis
    112307303 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112307303 (CD40LG)
   04090 CD molecules [BR:dro04090]
    112307303 (CD40LG)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Tumor necrosis fators
   112307303 (CD40LG)
CD molecules [BR:dro04090]
 Proteins
  112307303 (CD40LG)
SSDB
Motif
Pfam: TNF DUF5677
Other DBs
NCBI-GeneID: 112307303
NCBI-ProteinID: XP_024419159
Position
Unknown
AA seq 260 aa
MIETYSQPSPRSVTSGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKMIQRCNKGERSLSLLNCEEIRSQFETFVKDIMGNEVKEKEKTFEMQKGDQDPQ
IAAHVISEASSKTASVLQWAQKGYYTMSNNLVTLENGKQLAVKRQGLYFIYAQVTFCSNR
ETSSQAPFIASLCLRSTSGSERILLRAANTHSSSKPCGQQSIHLGGVFELQPGASVFVNV
TDPSQVSHGTGFTSFGLLKL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgatcgaaacatacagccaaccttctccccgatctgtgaccagtggaccacccgtcagc
atgaaaatttttatgtatttacttactgtttttcttatcactcagatgattgggtccgca
ctttttgctgtgtatcttcacagaagattggacaagatagaagatgaaaggaatcttcat
gaagattttgtgttcatgaaaatgatacagaggtgcaacaaaggagagaggtccttatcc
ttactgaactgtgaggaaattagaagccagtttgaaacctttgtcaaggatataatggga
aatgaagtgaaggagaaagaaaaaacctttgagatgcaaaaaggtgatcaggatcctcaa
attgcagcacatgtcataagtgaggccagtagtaaaacagcatctgttctgcagtgggcc
caaaaaggatactacaccatgagcaacaacttggtaacccttgaaaatgggaaacagctg
gccgttaaaagacaaggactctattttatctatgcccaagtcactttctgttccaatcgg
gaaacttcgagtcaagctccatttatagccagcctctgcctgaggtccacaagtggatct
gagagaatcttacttagagcggcaaacacccacagttcctccaaaccttgcgggcaacaa
tccattcacttgggaggagtgtttgaattgcaaccaggtgcttcagtgtttgtcaacgtg
actgatccaagccaagtgagccatgggactggcttcacgtcttttggcttacttaaactc
tga

DBGET integrated database retrieval system