KEGG   Desmodus rotundus (common vampire bat): 112307358
Entry
112307358         CDS       T05907                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04010  MAPK signaling pathway
dro04060  Cytokine-cytokine receptor interaction
dro04115  p53 signaling pathway
dro04210  Apoptosis
dro04217  Necroptosis
dro04650  Natural killer cell mediated cytotoxicity
dro04668  TNF signaling pathway
dro04932  Non-alcoholic fatty liver disease
dro04940  Type I diabetes mellitus
dro05010  Alzheimer disease
dro05142  Chagas disease
dro05143  African trypanosomiasis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112307358 (FAS)
   04668 TNF signaling pathway
    112307358 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112307358 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112307358 (FAS)
   04217 Necroptosis
    112307358 (FAS)
   04115 p53 signaling pathway
    112307358 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112307358 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112307358 (FAS)
   05205 Proteoglycans in cancer
    112307358 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112307358 (FAS)
   05330 Allograft rejection
    112307358 (FAS)
   05332 Graft-versus-host disease
    112307358 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112307358 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112307358 (FAS)
   04932 Non-alcoholic fatty liver disease
    112307358 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112307358 (FAS)
   05162 Measles
    112307358 (FAS)
   05164 Influenza A
    112307358 (FAS)
   05161 Hepatitis B
    112307358 (FAS)
   05160 Hepatitis C
    112307358 (FAS)
   05168 Herpes simplex virus 1 infection
    112307358 (FAS)
   05163 Human cytomegalovirus infection
    112307358 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112307358 (FAS)
   05169 Epstein-Barr virus infection
    112307358 (FAS)
   05165 Human papillomavirus infection
    112307358 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112307358 (FAS)
   05143 African trypanosomiasis
    112307358 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112307358 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dro04050]
    112307358 (FAS)
   04090 CD molecules [BR:dro04090]
    112307358 (FAS)
Cytokine receptors [BR:dro04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   112307358 (FAS)
CD molecules [BR:dro04090]
 Proteins
  112307358 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 BatA
Other DBs
NCBI-GeneID: 112307358
NCBI-ProteinID: XP_024419201
Position
Unknown
AA seq 533 aa
MPAPQVCTPSRESLKPETHSRNSLGPQKDSPDSTIKRQEVHTETAKAISGVCVLIAHLLV
DAQIAALVSRPDAEPVPWVAPPAQEHIHAEDVGTAGTGLAQRGSSSQHSLPSAGPRRRDS
TATPTGRAGAVAGHPGTRFSWGAVPGTRGRRCFGGSRAESWRLGAAGTREVQSRWRDGWA
GEMRGASGPVLTSPAEGPLCAGGRDRGQDVAELALGGADITHFPALVRFRILTFELLESS
QNVTKRASECPAGQQREGKFCCRPCLPGERKRSDCRDDGEKLVCEPCPEGQEYTEKTHYS
NKCRRCKTCDGEQGLEVEINCTKTRNTKCRCRPNFFCNTPPCEHCDPCSTCEYGVDEKCT
PTTNTRCKEGPRSHLLWLFLLLVIPISAVIYFWVKRQRRTTNNDHDETVPPNTEMTPMNP
TDVNLSDYIIIIAEKMTINQVKEFVRKNGINEAKIDEIKNNNLQDTAEQKVQLLRNWYQL
HGKKDAYSTLIKGLQKANLHALVEEIQGIVQKDNTDKHENANSNKENESQSLV
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgccagcccctcaagtgtgcactcctagtagagagagcctgaagccagagacccattca
cgcaatagccttgggccacagaaagacagtcctgactccactatcaaacgccaggaagtg
catacagaaacagcaaaggccatttccggtgtctgtgtcctcatcgcacacctgctcgtg
gatgcacaaattgccgccctggtcagccggccagacgccgagcccgtgccgtgggtagca
ccgccagcccaggagcacattcatgcagaagatgtggggactgcaggaacagggctggcc
cagcgggggtcttcctcgcagcactcactcccgtccgctgggccgagacgccgagacagc
acagcaactcctacaggacgggcaggggccgtcgcgggacacccgggaactcgcttttct
tggggtgcggtaccaggcacgcggggtagacggtgcttcggcgggagccgcgccgagagc
tggcggctgggggcggcagggacccgggaggttcagagtcgctggagggacggctgggct
ggagagatgaggggcgcttctggacccgtccttacaagtccagctgaaggtccgctctgc
gcgggtgggcgtgatcgcggccaggacgtggcagaacttgcgctcggaggagctgacatt
acccactttcccgcccttgtgcggtttaggatacttacctttgagctgctggaatcaagt
cagaatgttactaaaagggcgtctgagtgcccagcaggccaacagcgcgagggcaaattc
tgctgtcggccgtgtcttcctggtgaacggaaacgcagtgactgcagggatgacggggag
aagctagtctgtgagccctgcccagaagggcaggagtacacagagaagacacattattct
aacaagtgcagacgatgcaaaacttgtgatggagaacaaggcctagaagtggaaataaac
tgtaccaagacccggaataccaagtgcagatgtagaccaaactttttctgtaacactcct
ccttgcgaacactgtgatccttgcagcacgtgtgaatatggagtcgatgagaaatgcaca
ccaaccaccaacaccagatgcaaagaaggacccagatcccacttactgtggctgtttctc
ctcctggtgattccaatatctgcagtaatttatttttgggtgaaaagacagcgccggact
actaataatgatcacgatgaaactgtacctccaaatactgaaatgaccccaatgaatcca
acagatgttaacttgagtgactatattatcattattgctgaaaaaatgacaataaatcaa
gtgaaagagtttgttcggaagaatggtatcaacgaagccaaaattgatgaaatcaaaaat
aacaacctccaagacacagctgaacagaaggtccagctgctccgtaattggtatcaactt
catgggaagaaagatgcatattccactttgattaaaggtctccagaaagctaatcttcat
gctcttgtagaggaaattcaaggcatagtccaaaaggacaatactgataaacatgaaaat
gctaactccaacaaggaaaacgaaagccaaagcttggtctaa

DBGET integrated database retrieval system