KEGG   Desmodus rotundus (common vampire bat): 112307542
Entry
112307542         CDS       T05907                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dro01002]
    112307542 (ERAP1)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     112307542 (ERAP1)
Peptidases and inhibitors [BR:dro01002]
 Metallo peptidases
  Family M1
   112307542 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 112307542
NCBI-ProteinID: XP_024419374
Position
Unknown
AA seq 941 aa
MIALSNKWPLGMVSFLSSSLLILLIGSTPSWCQSSKATSPKASNGKPFPWNEMRLPEHVI
PVHYDLMIHANLTTLTFEGTTAIDITASQPTTAIILHSNHLQISKATLRKGAGVRQSDEP
LKVLEHLPHEQIALLAPEPLVAGLLYTVVIDYAGNLSESFHGFYKSTYRTKEGEVRVLAS
TQFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVRSVTVAEGLIEDHFDVT
VKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAVPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVCVTHPELRVEDYFFGKCFDAMEVDALNSSHPV
STPVENPAQIREMFDEVSYEKGACILNMLRDYLGADTFKSGIIHYLQKYSYKNTKNEDLW
NSMASICPPDTQRMDGFCSRGQHSSSSSHWKQEGLDVKAMMNTWTMQQGFPLITVTVRGR
NIHMKQERYLKGRDDAPESGYLWHVPLTFITSKSDSAHRFLLKTKTDVLILPEEVEWIKF
NVGMNGYYIVHYEDDGWDSLTGLLKGTHTAISSNDRASLINNAFQLVSIGKLPIEKALDL
TLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRGLIDKQTWTDEG
SVSERMLRSQVLLLACVRKYQPCVQKAEGYFREWKEANGNLRLPNDVTLAVFAVGAQTAG
GWDFLYSKYQSSLSSTEKEQIEFALCVSQDTEKLQWLLEQSFQGDVIKTQEFPGILRAIG
RNPVGYPLAWQFLRENWNKLVQKFELGSASIAYMVMGTTNQFSTRARLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIRWMDKNFDKIRAWLQNEKLELL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atgatagctctgtccaacaaatggccacttggaatggtgtcatttctatcttcctcactg
ttgattctcttaattgggtcaaccccttcctggtgtcagagtagcaaagctacgtctcca
aaagctagtaatgggaaaccgtttccttggaatgaaatgagacttcctgagcacgtcatc
ccagttcattatgatctcatgatccatgcgaatctcaccactctgactttcgaggggacc
acagccatagacatcacagccagccagcccaccactgccatcatcctgcacagtaaccac
ctgcaaatatccaaggccaccctcaggaagggagctggcgtgaggcagtctgatgagccg
ctgaaagtcctggagcatctgcctcacgagcaaatcgcacttctggctcccgagcctctg
gttgctgggctcctgtacacagttgtcattgattatgccggcaatctttctgagagcttc
catggattttataaaagcacctaccgaaccaaggaaggggaagtgagggtgctggcttca
acacagtttgaacctactgcggccagaatggcctttccctgctttgatgaacctgccttc
aaagcgagtttttcaatcaagatcagaagagaaccaaggcacctcgccatctccaacatg
cccttggttagatccgtgactgtggccgaaggactcatagaagaccatttcgatgtcact
gtcaagatgagcacctacctggtggccttcattatttcagattttaagtctgtcagcaag
atgaccaagagcggagtcaaggtttccgtgtatgctgtgcccgacaagataaaccaggca
gattacgcactggatgctgcggtgactcttctagaattttatgaggattattttagcatt
ccgtatcccttgcccaaacaagatctcgctgctgttcccgactttcagtctggcgctatg
gaaaactggggactgacgacatatagggagtccgctctgttgtttgatgctgaaaagtct
tctgcatccagtaagctcggcatcaccatgactgtgtcccatgaactcgcccaccagtgg
tttgggaacctggtcactatggaatggtggaatgatctttggctaaatgagggatttgcc
aagttcatggagttcgtgtctgtctgtgtgactcacccagaactgagagttgaagattat
ttctttggcaagtgttttgatgcgatggaggtagatgcattaaattcttcgcatcccgtg
tccacgcctgtggagaatcctgctcagattcgggagatgtttgatgaggtttcttatgaa
aagggagcgtgtattctgaatatgctaagggattatcttggtgccgatacatttaaaagt
ggcatcatacattatctccagaagtatagctataaaaacacgaaaaacgaggacctgtgg
aatagcatggcaagtatttgtcctccagatacacaaaggatggatggcttttgctctagg
ggtcaacactcatcttcatcctcacactggaagcaggaaggcctcgatgtgaaagccatg
atgaacacctggacgatgcagcagggctttcccctgataaccgtcaccgtgagagggagg
aacatacacatgaagcaagaacgctatctcaaaggacgcgacgatgccccagagtctggg
tacctgtggcatgttccactgacattcatcaccagcaaatcagactcagcccacagattt
ttgctgaagacaaaaacagatgtgctcattctcccagaagaggtggaatggatcaaattt
aatgtgggaatgaacggctattacattgtgcattatgaggatgatggatgggattctttg
actggccttttaaaaggaacacacacagcaatcagcagtaatgatcgagccagtctcatt
aacaatgcatttcaacttgtcagcattgggaagctaccaattgaaaaagccttggattta
accctgtacctgaaacatgaaactgaaattatgcccgtgttccaaggtttgaatgagctg
atacccatgtataagttaatggagaaacgagatatgaatgaagtggaaactcaattcaag
gcctttctcatcaggctgctgaggggcctcattgataagcagacctggactgacgagggc
tccgtctcagagcgaatgctgcggagtcaggtcctcctcctcgcctgtgtgcgcaagtat
cagccctgtgtgcagaaggcagaaggctacttcagagagtggaaggaagccaatggaaat
ttgagactgcccaacgatgtgaccttggctgtgtttgccgtgggagcccagaccgcggga
ggatgggatttcctttatagtaaatatcagtcttccttgtccagtaccgagaaagaacaa
atcgaatttgccctctgtgttagccaagatacggaaaagcttcagtggctactagaacaa
agttttcaaggagatgtgataaaaactcaagaatttccaggtattcttagagctattggc
agaaacccagtgggctatccattggcctggcagttcctgagggaaaactggaataaactt
gtacaaaagtttgaacttggctcagcttccatagcctacatggtaatgggaacgacaaat
caattctccacaagagcacgccttgaagaggtaaaaggattcttcagctctttgaaagaa
aatggttctcagctccgttgtgtccaacaaacaattgaaaccattgaggaaaacatacgt
tggatggacaagaactttgataaaatcagagcgtggctccaaaatgaaaagcttgaactg
ctgtga

DBGET integrated database retrieval system