KEGG   Desmodus rotundus (common vampire bat): 112307792
Entry
112307792         CDS       T05907                                 

Gene name
INPP5D
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
  KO
K03084  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 [EC:3.1.3.86]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro04070  Phosphatidylinositol signaling system
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112307792 (INPP5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112307792 (INPP5D)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112307792 (INPP5D)
   04664 Fc epsilon RI signaling pathway
    112307792 (INPP5D)
   04666 Fc gamma R-mediated phagocytosis
    112307792 (INPP5D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112307792 (INPP5D)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.86  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase
     112307792 (INPP5D)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112307792 (INPP5D)
SSDB
Motif
Pfam: SH2 Exo_endo_phos
Other DBs
NCBI-GeneID: 112307792
NCBI-ProteinID: XP_024419727
Position
Unknown
AA seq 1176 aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEE
DKFTVQASEGVPMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDPGDEPEEETEGVP
CPPELPPRNIPLSAGPCEAKEVPLLIENPRATEVSRPSLSETLFQRLQSMDTSGLPEEHL
KAIQDYVSTQLSLDAEFVKTGSSSLPHLKKLTVFLCKEVYGEVIRTLPSLESLQRLFDQQ
LSPGLRPRPQVPGEASAINMVTRLSQLTSLLSSIEDKVKALLHEGPEAPHRRSLIPPVTF
EVKSESLGIPQKLQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVILV
ETEKEKTLRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPKK
ITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLGEKDWLEILRNSLQEITSITFKTIA
IHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSH
LTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWLGDLNYRVDLPTWEAEA
IIQKIKQQQYTDLLAHDQLLTERKEQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKA
TGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKNG
PGTVDSQGQIEFLRCFATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKFG
ETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETELPIYTPLTHHG
EMTGHFRGEIKLQTSQGKMREKLYDFVKTERDEASGPRCLKSFTSHDPGKQWEPANRVPL
CTSSSITEIINPNYIGMGSLGHMKQALSPEQQPTAWSYDQPLKDSSLVPGRGESPPTPPS
QPPISPKKFSSSTATRGPCPRTQESRPGDLEPLPQEEPKLPKPEMFENPLYGSVSSFPKP
APRREQESPKMLRKEPPLCPDTGSLSPSILLSKAQEAEGSKGTGKPVPTPRLRSFTCSTS
AEGRPAAGDKSQGKAKGPASAQAPVPAKRPVKPSRSELSQQALPTPAPRPPLPAKSPAVL
HLQYAKGRDYRDNTELPHQGKHRPPEDSPLSRAATQ
NT seq 3531 nt   +upstreamnt  +downstreamnt
atggtcccctgctggaaccatggcaacatcacccgctccaaagccgaggagctgctctcc
aggactggcaaggatgggagcttcctcgtgcgcgccagcgagtccatctcccgggcctac
gcgctctgcgtgctgtatcggaactgcgtttatacctaccggatcctgcccaatgaggag
gataaattcactgtccaggcgtctgaaggtgtccccatgagattcttcaccaagctggac
cagctcatcgagttttacaagaaggagaatatgggcctggtgacccacctgcagtaccca
gtgccactggaggaggaggaccccggggacgagccggaggaggagacagaaggtgtccca
tgtcctcctgagctgccgccgagaaacatccctctatccgctgggccatgtgaggccaag
gaggtccctctcttgatcgagaacccaagagccaccgaggtcagccggccaagcctctcc
gagacgttgtttcagcggctgcagagcatggacaccagcgggcttccagaagagcatctt
aaagccatccaggactacgtgagcactcagctctccctggacgccgagtttgtgaagacc
ggctccagcagcctccctcacctgaagaaactgacagtgttcttgtgcaaggaggtgtat
ggagaagtcatccggaccctcccctccctggagtctctgcagagattatttgaccagcag
ctctccccgggcctccgtcctcggcctcaggtgcctggcgaggccagtgcgatcaacatg
gtgaccaggctcagccaactgacaagtctgctgtcctcgattgaagataaggtcaaagct
ttgctgcacgagggtcccgaggctccccaccggaggtctctcatccctccagtcaccttt
gaggtgaagtcagagtctctggggattcctcagaagttgcagctcaaagttgatgtcgag
tctgggaaactgatcattaagaagtccaaggacggctccgaggacaagttctacagccac
aagaaaatcctgcagcttatcaagtctcagaagtttctgaacaagttggtgattttggtg
gaaacagagaaggagaagaccctgcggaaggaatatgtttttgctgactccaaaaaaaga
gaaggcttctgccagctcctgcagcagatgaagaacaagcactcagagcagccggagccc
gacatgatcaccatcttcatcggcacctggaacatgggtaacgccccccctcccaagaag
atcacgtcctggtttctctccaaggggcagggaaagacgcgggatgactctgccgattac
atcccccacgacatctacgtgatcggcacccaggaggacccactgggcgagaaggattgg
ctggagatcctcagaaactccctgcaagaaatcaccagcataacttttaaaacgattgcc
atccacacgctctggaacattcggattgtggtgctggccaagccagagcatgagaaccgg
atcagccacatctgcaccgacaacgtgaagacgggcatcgccaacactctggggaacaag
ggagctgtgggggtgtcattcatgttcaatgggacctccttggggtttgtcaacagccac
ttgacgtccggaagtgaaaagaaactcaggcgaaaccaaaactatatgaacattcttcgg
tttctggctctgggagacaagaaactgagtcccttcaacatcactcaccgattcacccac
cttttctggcttggggacctcaactaccgtgtggatctgcccacctgggaggcggaagcc
atcatccagaagatcaagcagcagcagtacacagacctcctggcgcacgaccagctgctc
acggagaggaaggagcagaaggtgttcctgcacttcgaggaggaagaaatcacgttcgcg
cccacctaccgttttgaaagactgactcgggacaaatacgcctacactaagcagaaggcc
acggggatgaagtacaacctgccctcctggtgtgaccgcgtcctctggaagtcctacccg
ctggtgcacgtggtgtgtcagtcctacggcagcaccagcgacatcatgacaagtgaccac
agccctgtttttgccacatttgaggcaggagtcacctcccagtttgtctccaaaaatggt
cccgggactgtcgacagccaagggcagatcgagtttctcagatgcttcgccaccctcaag
accaagtcccagaccaaattctacctggagttccactcaagctgcttggagagtttcgtc
aagagtcaggaaggagaaaacgaagaagggagtgaaggggagctggtggtgaagtttggc
gagaccctcccaaagctgaagcccattatttccgaccctgagtacctgctggaccagcac
atcctgattagcattaaatcctctgacagtgacgagtcctacggcgagggctgcattgct
ctacggttagaggccacggaaactgagctccccatctacacgcctctcacccaccacgga
gagatgacgggccacttccggggggagatcaagctgcagacctcccagggcaagatgagg
gagaagctgtacgacttcgtgaagaccgagcgggatgaggccagcgggcccaggtgtctg
aagagcttcaccagccacgaccccgggaagcagtgggaacctgccaacagggtccctctc
tgcacaagctccagcatcactgaaatcatcaaccccaattacatcggcatggggtccttg
gggcatatgaaacaggccctgtcccccgaacagcagcccacagcctggagctacgaccag
ccgctcaaggattcctccctggtacctgggaggggggagagccctccaacacctccctcc
caaccacccatatcacccaagaagttttcgtcctccacagcgacccggggcccctgcccc
aggacgcaggagtccaggcctggcgacctagaacctttgccgcaggaggagcccaagctg
cccaagcccgagatgtttgagaacccgctgtacgggtctgtgagctctttccctaagccg
gctcccaggagagagcaggagtctcccaaaatgctgaggaaggagcccccactgtgcccg
gacacagggtccttgtcccccagcatcctgctctccaaagcccaggaggccgagggcagc
aaggggacaggcaagccggttcccacaccccggctccgctccttcacttgctcgacctct
gctgagggccggccagccgcgggggacaagagccaagggaaggccaagggccctgccagc
gcccaagccccagtgccagccaagaggcccgtcaagccttccaggtcggagctgagccag
caggccctgcccaccccggccccacggccacccctcccggccaagagcccggcagtcctg
cacctgcagtacgccaagggccgcgactaccgtgacaacaccgagctgccccaccagggc
aagcaccggccccccgaggactcgccgctcagcagggctgccacgcagtga

KEGG   Desmodus rotundus (common vampire bat): 112315920
Entry
112315920         CDS       T05907                                 

Gene name
INPPL1
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
  KO
K15909  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2 [EC:3.1.3.86]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro04070  Phosphatidylinositol signaling system
dro04662  B cell receptor signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112315920 (INPPL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112315920 (INPPL1)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112315920 (INPPL1)
   04666 Fc gamma R-mediated phagocytosis
    112315920 (INPPL1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112315920 (INPPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112315920 (INPPL1)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.86  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase
     112315920 (INPPL1)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    112315920 (INPPL1)
SSDB
Motif
Pfam: Exo_endo_phos SAM_2 SAM_1
Other DBs
NCBI-GeneID: 112315920
NCBI-ProteinID: XP_024428350
Position
Unknown
AA seq 1232 aa
MHGSGFGWQQEKVPWGLDASLGVTDSDLCLAIRYQKHVHTYRILPDGEDFLAVQTSQGVP
VRRFQTLGELIGLYAQPNQGLVCALLLPVEREREPDPPDDRDASDGEDEKPPLPPRSGST
SICASMGPSSPQPAPETPATPAAESAPNGLSTVSHEYLKGSYGLDLEAVRSGASNLPHLT
RTLATSCRRLHSEVDKVLSGLEILSKVFDQQSSPMVTRLLQQQNPPQTGEQELESLVLKL
SVLKDFLSGIQKKALKALQDISSTAPPAPLQPCTRKAKTIPVQAFEVKLDVTLGDLTKIG
KSQKFTLSVDVEGGRLVLLRRQRDSQEDWTTFTHDRIRQLIKSQRVQNKLGVVFEKEKDR
TQRKDFIFVSARKREAFCQLLQLMKNKHSKQDEPDMISVFIGTWNMGSVPPPKNVTSWFT
SKGLGKTLDEVTVTIPHDIYVFGTQENSVGDREWLDLLRGGLKELTDLDYRPIAMQSLWN
IKVAVLVKPEHENRISHVSTSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVNCHLTSGNE
KTARRNQNYLDILRLLSLGDRQLNAFDISLRFTHLFWFGDLNYRLDMDIQEILNYISRKE
FEPLLRVDQLNLEREKHKVFLRFSEEEISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPS
WCDRILWKSYPETHIICNSYGCTDDIVTSDHSPVFGTFEVGVTSQFISKKGLSKTSDQAY
IEFESIEAIVKTASRTKFFIEFYSTCLEEYKKSFENDAQSSDNINFLKVQWSSRQLPTLK
PILADIEYLQDQHLLLTVKSMDGYESYGECVVALKSMIGSTAQQFLTFLSHRGEETGNIR
GSMKVRVPTERLGTRERLYEWISIDKDEAGAKSKAPSVSRGGQEPSRSGSRKPAPTEASC
PLSKLFEEPEKPPPTGRPPAPPRAAPREEPLTPRLKPEGAPEPEGVAAPPPKNSFNNPAY
YVLEGVPHQLLPPEPPPPARAPVPSTTKNKVAITVPALQLGRHRPPRVGEGSSSDEESGG
TLPPPDFPPPPLPDSAVFLPPGLDPLPGPVVRGRGGGEARGPPPPKAHPRPPLPPGPSPT
STFLGEVTSGDDRSCSVLQMAKTLSEVDYAPAGPGRSVLLPGPLELQPPRGLPSDYGRPL
SFPPPRIRESIQEDLAEEAPCPQSGRPPGLGEAGMGAWLRAIGLERYEEGLVHNGWDDLE
SLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
NT seq 3699 nt   +upstreamnt  +downstreamnt
atgcatggcagtggttttgggtggcaacaggagaaggtaccttggggcttagatgctagc
ttgggagtgacagattctgacctctgccttgctatcaggtatcagaagcatgtgcacacc
tatcgaattctacctgatggggaggacttcctggctgtgcagacctcccagggtgtgccc
gtgcgccgcttccagaccctgggcgagctcatcggcctgtatgcccagcccaaccagggc
ctcgtgtgcgccctgctattgcctgtggagcgggagcgagagccagacccaccagacgac
cgcgatgcctcagatggggaggacgagaagcccccgctgcccccacgctctggctccacc
agcatttgtgcttctatggggcccagcagcccccaaccagcccctgagacgcctgcaact
ccggctgctgagagtgctcccaatgggctgagcactgtctcgcacgagtacctgaagggc
agctacgggctggacctggaggctgttcggagcggagccagcaacctgccccacctcacc
cgtaccctcgccacctcatgccggaggctgcacagtgaggtggataaggtcctgtctggc
ctggaaattctgtccaaggtgtttgaccagcagagctcgccgatggtgacccgccttttg
cagcagcagaacccaccacagactggggaacaggaactagagagcctggtgctgaagctg
tccgtgttaaaggacttcctgtcaggcatccagaagaaggccctgaaggccctacaagac
ataagttccacagcacccccggctcccctgcagccatgcacgcgtaaggccaagaccatc
cctgtgcaggcctttgaggtgaagctggatgtgaccctgggtgatctgaccaagattggg
aagtcacagaagttcacgctgagcgtggatgtggagggcgggcggctagtgttgctgcgg
agacagcgagactcgcaggaggactggacaaccttcacgcatgaccgaattcgccagctc
attaagtctcagcgtgtccagaacaagctgggtgttgtattcgagaaggagaaagaccgg
acacagcgcaaggacttcatctttgtcagtgcccggaagcgggaggccttctgccagctg
ctgcagctcatgaagaacaagcactcaaagcaggatgagcctgacatgatctctgtcttc
ataggcacctggaacatgggaagtgtgccacctccgaaaaatgtgacatcttggttcaca
tcgaagggattggggaaaaccctggatgaggtcacagtgaccataccccatgacatctat
gtttttgggacccaggagaactcggtgggtgaccgagaatggctggacctgctacgcggg
ggcctcaaggagctcacagatttggactaccgcccgattgccatgcagtcactgtggaac
atcaaagtggctgtgctggtcaagccagagcacgagaaccgcatcagccacgtcagcacg
tccagcgtgaagactggtattgccaacaccctgggaaacaagggggccgtgggtgtctcc
ttcatgttcaatggcacttcgtttggctttgtgaattgccacctcacctcgggaaatgag
aagactgcccggcggaaccagaactacctggacattcttcggctgctctcgctgggtgac
cgccagctcaatgcctttgacatctctctgcgtttcactcacctcttctggtttggggac
ctcaactaccgcctggacatggatatccaggagatcctgaattacatcagcaggaaggag
tttgagcccctgctcagggtagaccagcttaacttggagcgggaaaagcacaaagtcttc
ctccgattcagtgaggaggagatctccttcccgcccacctaccgctacgagcggggttcc
cgggacacatatgcctggcacaagcagaaaccaactggggtccggaccaacgtaccttca
tggtgtgaccggattctctggaaatcctaccccgagacccacatcatctgcaattcctac
ggttgcaccgacgatattgtcaccagtgaccattcccctgtgtttgggacatttgaggtt
ggagttacctctcagttcatctccaagaaagggctctcaaagacttcagaccaggcctac
attgagtttgagagcatcgaggccattgtgaaaacagccagccgcaccaagttcttcatt
gagttctactccacctgcctggaagagtacaagaagagcttcgagaacgatgcccagagc
agtgacaacatcaacttcctcaaagtgcagtggtcttcacgccagctgcccacgctcaag
ccaattctggctgacattgagtacttgcaggaccagcacctcctgctcacagtcaagtcc
atggatggctatgaatcctatggggagtgcgtggtggcactcaagtccatgattggcagc
acagcccagcagttcctgaccttcctgtcccaccgcggcgaggagacaggcaacatccgt
ggctccatgaaggtgcgggtgcccaccgagcgcctgggcacccgtgagcgactctacgag
tggatcagcatcgataaggacgaggcaggagcaaagagcaaagctccctctgtgtcccga
ggtggccaggagcccagcaggtcagggagccgaaagccagcccccacagaggcctcctgc
ccgctgtccaagttatttgaagaaccagagaaaccaccaccaactgggaggccaccagcc
ccacctcgagctgctccccgggaggagcctttgacccccaggttgaagccagagggggct
ccagagcctgaaggggtggcagctcccccacccaagaacagcttcaataaccctgcctac
tacgtcctggaaggggtcccacaccagttgctgcccccagagccacctccgcctgccagg
gcccctgtcccatccaccaccaagaacaaggtggccatcacagtacctgctctacagctt
gggcgccaccggcctccccgtgtgggagaggggagctcatctgacgaggagtcggggggc
acactgccccctccagacttcccacccccaccactgccggactcggccgtcttcctgccg
ccaggcttggaccctctgccggggccagtggtccggggccgtggtgggggtgaggcccgt
ggcccaccacctcccaaagcccatccgagacccccgctgcccccaggcccctcgcccacc
agcactttcttgggagaggtaaccagcggggacgatcgctcctgctcagtgctgcagatg
gccaagacactgagtgaagtggactacgctcctgcggggcctggccgctcagtgctcctg
ccaggccccctggaactgcagccacccaggggcctgccctcagactatggccggcctctc
agcttccctccaccccgaatccgggagagcatccaggaggacctggcagaggaggctccg
tgcccgcagagcgggcggcctcctgggctgggtgaggcgggcatgggcgcctggctgcgg
gccatcggcttggagcgctatgaggagggcctggtgcacaatggctgggatgacctggag
tccctcagtgacattacagaggaggacctggaagaggctggggtgcaggacccagctcac
aagcgcctccttctggacaccctgcagctcagcaagtga

DBGET integrated database retrieval system