KEGG   Desmodus rotundus (common vampire bat): 112307808Help
Entry
112307808         CDS       T05907                                 

Gene name
NOP58
Definition
(RefSeq) nucleolar protein 58 isoform X1
  KO
K14565  nucleolar protein 58
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    112307808 (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dro03009]
    112307808 (NOP58)
Ribosome biogenesis [BR:dro03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    112307808 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 112307808
NCBI-ProteinID: XP_024419746
Position
Unknown
AA seq 540 aa AA seqDB search
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF
TALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIR
SQMDGLIPGVEPREMTAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYI
MRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAQLSELLPEEVEAEVKAAAEI
SMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISR
MLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRALEDRGIRKISGTGKALAKAEKYE
HKSEVKTYDPSGDSTLPTCSKKRKIEQVDQEDEIIEKKAKKSKVKVKVEEEVVVEEEEEE
QAEEVLGVEEQEIPVKKKKKKDKKKRIKEEPLSEEEPCTSTAIPSPEKKKKKKKKKDNED
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgctgtttgaaacgtccgtgggctacgccatctttaaggttttgaatgagaag
aaacttcaagaggttgatagtttgtggaaagaatttgaaactccagaaaaagcaaataaa
atagttaagctgaaacattttgagaagtttcaggatacagcagaagcattggcagcattc
acagccctgatggagggcaaaatcaacaagcaactgaagaaagttctgaagaaaatagta
aaagaagcccatgaacccctggctgtagctgatgctaaactaggaggggtcataaaggaa
aagctgaatctcagttgcatccatagtcctgttgttaatgaacttatgagaggaattcgt
tcacagatggatggcttaatccctggggtagaaccacgtgaaatgacagccatgtgtctt
ggattggcccatagcttgtcccgttacagattgaaatttagtgctgacaaagtggacaca
atgattgtccaggcaatttccttgttggatgacttagataaagaactaaacaactacatc
atgcggtgtagagaatggtatggttggcattttcctgaattaggaaaaattatttcagat
aacttgacatactgcaagtgtttgcagaaagttggcgataggaagaattatgcctcggct
caactttctgaattactgccagaggaagttgaagcagaagtgaaagcagctgcagagata
tctatgggaacagaggtttcagaagaagatatttgcaacattctgcatctctgtactcag
gtgattgaaatctcagaatacagaacccagctctatgagtacctacaaaaccgaatgatg
gccattgcacccaatgttaccgtcatggttggggaattagttggagcacggcttattgct
catgcaggttctcttttgaatttggccaaacatgcagcttctacagttcagattcttgga
gcagaaaaggcacttttcagagctctaaagtctaggcgagatacccctaagtatggtctc
atttatcatgcttcacttgtaggccagacaagtcccaaacacaaaggaaagatttctcga
atgttggcagccaaaactgttttggctatccggtatgatgcttttggtgaagattccagt
tctgcaatgggagttgagaacagagccaaattagaggccaggttgagggccttggaagat
agagggataaggaaaataagtggaacaggaaaagcattagcaaaagcagaaaagtatgaa
cataaaagtgaagtgaagacttatgatccttctggtgactccacactgccaacctgttct
aaaaaacgcaagatagaacaggtagatcaagaggatgaaataattgaaaagaaggccaaa
aaatctaaggttaaagttaaagttgaagaagaagtagtagtagaagaagaagaagaagaa
caagcagaagaagtactaggggtggaagaacaggagatacctgtgaagaagaagaagaaa
aaggacaagaagaaacgcattaaggaagaaccgctttctgaggaagaaccgtgcaccagc
acagcaattcctagtccagagaaaaagaagaaaaagaaaaaaaagaaagataatgaggac
taa

DBGET integrated database retrieval system