KEGG   Desmodus rotundus (common vampire bat): 112307921Help
Entry
112307921         CDS       T05907                                 

Gene name
GMPPA
Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00051  Fructose and mannose metabolism
dro00520  Amino sugar and nucleotide sugar metabolism
dro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    112307921 (GMPPA)
   00520 Amino sugar and nucleotide sugar metabolism
    112307921 (GMPPA)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     112307921 (GMPPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep DUF4954
Motif
Other DBs
NCBI-GeneID: 112307921
NCBI-ProteinID: XP_024419863
Position
Unknown
AA seq 464 aa AA seqDB search
MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQ
PDEPLTRFLEAAQQQFNLPVRYLQEFAPLGTGGGLYHFRDQILAGGPEAFFVLNADVCSD
FPLNAMLAAHRQQPHPFLLLGTTANRTQSLSYGCIVENPQTHEVLHYVEKPSTFVSDIIN
CGIYLFSPEALKPLRDVFQRNQQDGQLEDSSGLWRGAGTIRLEQDVFSALAGQGQIYVHL
NDGIWSQIKSAGSALYASRLYLGQYQLTHPERLAKHTPGGPWIRGNVYIHPTAKVAPTAV
LGPNVSIGEGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPNDP
NPNDPRAHMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELTSASVLLLQS
EALKAPSLAAPPSTLPCCCRLPARLPVPLHWAWLRPWSAGFQRE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagctgtgatcctgattggaggccctcaaaaggggactcgcttcaggcctttg
tcttttgaggtgcccaaacccctatttccagtggcaggggtccctatgatccagcaccac
atcgaggcctgtgcccaggtccctgggatgcaggagattctgctcattggcttctaccaa
cctgatgagccgcttacccggttcctagaagctgcccagcagcagtttaaccttccagtc
aggtacctgcaggaatttgcccctctgggcacaggaggtggtctctaccatttccgggac
cagatcctggctggggggcccgaggccttcttcgtgctcaacgctgatgtttgctccgac
ttccccttgaatgccatgttggctgcccacagacagcagcctcaccctttcttgctcctg
gggaccacggctaacaggacacaatccctcagctacggctgcatcgtagagaacccacag
acccatgaggtcctgcactatgtggagaagcccagcacctttgtcagtgacatcatcaac
tgtggcatctacctcttttccccagaagccctgaaaccccttcgggatgtcttccagcgt
aatcagcaggatgggcaactggaggactcttcaggcctgtggcggggggcaggtaccata
cgcctggagcaggatgtgttctccgccctggctgggcagggccagatctacgtgcacctc
aacgacggcatctggagccagatcaagtctgcgggctcagcactctatgcctcccgcctc
tatctgggccagtaccagctcactcacccagaacgcctggccaagcacaccccagggggg
ccatggatccgaggaaacgtctacatccaccccacagctaaggtggcccccacagcggtg
ctgggccccaatgtctccattggggagggggtgactgtaggcgagggtgtgcggctccga
gagagcattgtcctccacggagccacgctgcaggagcacacgtgtgttctgcacagcatt
gtgggctggggcagcactgtggggcgctgggcccgtgtggagggcacccccaatgacccc
aatcccaatgacccccgagcccacatggacagtgagagcctcttcaaggatgggaagctg
ctgcctgccatcaccatcctgggctgccgcgtccggatcccggctgaggtgctcatcctg
aactcgattgttctgccgcacaaggagctgacctcagcctcggtgctgctgctccagagt
gaggccctcaaggctcccagcctggcggccccgccttcaaccctaccctgctgctgccgc
ctgcccgcccgcctccctgttcctcttcactgggcctggctcaggccctggagtgcaggc
tttcagagggaatga

DBGET integrated database retrieval system