KEGG   Desmodus rotundus (common vampire bat): 112307972
Entry
112307972         CDS       T05907                                 

Gene name
CD28
Definition
(RefSeq) T-cell-specific surface glycoprotein CD28
  KO
K06470  CD28 antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04514  Cell adhesion molecules
dro04660  T cell receptor signaling pathway
dro04672  Intestinal immune network for IgA production
dro04940  Type I diabetes mellitus
dro05162  Measles
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05320  Autoimmune thyroid disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112307972 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    112307972 (CD28)
   04672 Intestinal immune network for IgA production
    112307972 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112307972 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    112307972 (CD28)
   05323 Rheumatoid arthritis
    112307972 (CD28)
   05320 Autoimmune thyroid disease
    112307972 (CD28)
   05330 Allograft rejection
    112307972 (CD28)
   05332 Graft-versus-host disease
    112307972 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112307972 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112307972 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    112307972 (CD28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dro04090]
    112307972 (CD28)
CD molecules [BR:dro04090]
 Proteins
  112307972 (CD28)
SSDB
Motif
Pfam: V-set_2 V-set DUF588 CD34_antigen
Other DBs
NCBI-GeneID: 112307972
NCBI-ProteinID: XP_024419913
Position
Unknown
AA seq 221 aa
MILRLLLALNLFPSIQVSENKILVKQSPMLVVNNNAVNLSCKYTYNLFSKEFRASLYKGA
DSAVEVCVVNGNYSHQLQFQSKTGFNCDGKLGNETVTFYLWNLFVNQTDIYFCKIEVMYP
PPYIDNEKSNGTIIHVKENQLCPAHQTPESSKPFWALVVVDGILALYSLLVTVALFTCWM
KNKRNRILQSDYMNMTPRRPGPTRRHYHPYAPARDFAAYRS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgatcctcaggctgctcctggctctcaacctcttcccctccattcaagtatcagaaaac
aagattttggtgaagcagtcgcccatgcttgtggtgaacaacaacgctgtcaaccttagc
tgcaaatacacctacaacctcttttcaaaggagttccgggcatccctttacaagggagca
gatagtgctgtggaagtttgtgttgtgaatggaaactactcccatcagcttcagtttcag
tcaaaaacgggattcaactgtgatgggaaattgggcaacgaaacagtgacattctacctc
tggaatttgttcgttaaccaaacagatatttacttctgcaaaatagaagtcatgtatcct
cctccttacatagacaatgagaagagcaatggaaccattatccatgtgaaagagaatcag
ctttgtccagctcaccaaactcctgagtcttctaagccattttgggcactggtggtggtt
gatggaatcttggctttgtatagcttgctagtaacagtggctctttttacttgctggatg
aagaataagaggaacaggatccttcagagtgactacatgaacatgaccccccggaggccg
gggcccactcgcagacactaccatccctatgccccagcacgagactttgcagcctaccgc
tcctga

DBGET integrated database retrieval system