KEGG   Desmodus rotundus (common vampire bat): 112308799
Entry
112308799         CDS       T05907                                 

Gene name
SIM2
Definition
(RefSeq) single-minded homolog 2
  KO
K09100  single-minded
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112308799 (SIM2)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112308799 (SIM2)
SSDB
Motif
Pfam: SIM_C PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 112308799
NCBI-ProteinID: XP_024420843
Position
Unknown
AA seq 574 aa
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRAGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLAAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAITEIKLHSNMFMFRASLDL
KLIFLDSRVTELTGYEPQDLIEKTLYHHVHGCDAFHLRYAHHLLLVKGQVTTKYYRLLSK
LGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTDIEYKELQLSLDQVSTSKSQDSWRTAL
STSQEARKLAKPKSTKMKTKLRTNPYPPQHYSPFPTDKLECGQLGNWRASPPADAAAPPE
QQLHAEGGDLLYAPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQASPCEVARFFL
STLPTGGECQWHYANPLVPSSPSPAKNLSEPPVSSARHSLAPNYEGGSRLRAGWGQGYDV
DQDPGGLGGLFLFLLLSRGCCIPLLLVRAPRESG
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgaaggagaagtccaagaatgcggccaagaccaggagggagaaggaaaatggcgagttt
tatgagctggccaagctgctgccgctgccgtcggccatcacctcgcagctggacaaggcg
tccatcatccgactcaccaccagctacctgaagatgcgcgcggtctttcccgaaggtcta
ggagacgcgtggggacagccgagccgcgccgggcctctggacagtgttgccaaggagcta
gggtcacacctgctgcagactttggacggatttgtgtttgtggtagcatctgatggcaaa
atcatgtacatatcggaaacggcctctgtccatttaggcttgtcccaggtggagctcacg
ggcaacagtatttatgagtacatccatccttcggaccacgatgagatgacagctgtcctc
gcggcccaccagcctcttcaccaccacctgctccaagagtacgagattgagaggtcattc
ttcctccgaatgaagtgtgtcctggcgaagagaaacgcgggcctgacctgcagcggatac
aaggtcatccactgcagcggctacttgaagatcaggcagtacatgctggacatgtccctc
tacgactcgtgctaccagatcgtggggctggtggccgtgggccagtcgctgccgcccagc
gccatcacggagatcaagttgcacagcaacatgttcatgttcagggccagccttgacctg
aagctgatattcctggattccagggtgacggagctgaccgggtatgagccgcaggacctg
atcgagaagaccctgtaccaccacgtgcacggctgcgacgccttccacctccgctacgcg
caccatctcctgctggtgaagggccaggtgaccaccaagtactaccggctactgtccaag
ctgggcggctgggtgtgggtgcagagctacgccaccgtcgtgcacaacagccgctcctcc
cggccccactgcatcgtgagtgtcaattatgtgctcacggacatcgaatacaaggagctg
cagctgtccctggaccaggtgtccacgtccaagtcccaggactcctggaggactgccttg
tctacctcacaagaagctaggaagttagcgaagcccaaaagtacgaagatgaagacaaag
ctgagaacaaacccttaccccccacagcactacagcccgttcccgacggacaaactggaa
tgcggccagctcggcaactggagagccagccccccagcggacgcagcggcccccccggag
cagcagctccatgcagaaggcggcgacctgctgtacgccccgtcctacagcctgcccttc
tcctaccattacggacacttccctctagactctcacgtcttcagcagcaaaaagccaatg
ttgccggccaaattcgggcagccccaagcgtccccgtgcgaggtggcacgcttcttcctg
agcacgctgccaaccggcggtgagtgccagtggcattatgccaaccccctagtgcctagc
agcccatctcctgcgaaaaacctctccgagccaccagtgagctccgctcggcacagcctc
gcaccgaactatgaaggtgggtcgcgtttgcgtgcggggtggggacagggctacgatgtg
gaccaggaccctggtggtctgggcgggcttttcctttttctgcttcttagtaggggttgc
tgcattcccctgctcttggtgcgagcacctcgcgagagtgggtaa

DBGET integrated database retrieval system