KEGG   Desmodus rotundus (common vampire bat): 112309355
Entry
112309355         CDS       T05907                                 

Gene name
BCL10
Definition
(RefSeq) B-cell lymphoma/leukemia 10
  KO
K07368  B-cell CLL/lymphoma 10
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04064  NF-kappa B signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112309355 (BCL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112309355 (BCL10)
   04660 T cell receptor signaling pathway
    112309355 (BCL10)
   04662 B cell receptor signaling pathway
    112309355 (BCL10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112309355 (BCL10)
SSDB
Motif
Pfam: CARD Flu_B_NS1
Other DBs
NCBI-GeneID: 112309355
NCBI-ProteinID: XP_024421327
Position
Unknown
AA seq 231 aa
MEPTALSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLRCS
NCEPFPDGAINSISRSNSDESNFSEKRRASTIMYHPEGESSTAPFFSTDSSLNLPVLEVG
KTENPTFSSTTLPRPGDPGAPPLPPELQLEGTCGNSSEMFLPLRSRALSRQ
NT seq 696 nt   +upstreamnt  +downstreamnt
atggagcccaccgcgctgtcccttaccgaggaggacctgactgaagtgaagaaggacgct
ttagagaatttgcgtgtgtatttgtgtgaaaaaatcatagctgagagacattttgatcat
ctacgtgcaaaaaaaatactcagtagagaagacactgaagaaatttcttgccgaacatca
agtagaaaaagggctggaaaattgttagactacttacaagaaaaccccaaaggactagat
acccttgttgaatctattcggcgagagaaaacacagaacttcctgatacagaagattaca
gatgaagtgctgaaacttcgaaatataaaactagaacatctaaaaggactaagatgtagc
aactgtgagccctttccagatggagccataaacagcatctctcgatcaaattcagatgag
agtaatttctctgaaaaacggagagcatccactatcatgtaccatccagaaggagaatcc
agcacagccccctttttttctactgattcatctctgaatttgcctgttctagaagtaggc
aaaactgaaaatcctaccttctcttcaactacacttcccagacctggcgaccccggggct
cctcctctgcccccagagctgcagttagaaggaacttgtggaaattctagtgagatgttt
ctccccctaagatcacgtgctctttcacggcaatga

DBGET integrated database retrieval system