KEGG   Desmodus rotundus (common vampire bat): 112310391
Entry
112310391         CDS       T05907                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04080  Neuroactive ligand-receptor interaction
dro04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112310391 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112310391 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 112310391
NCBI-ProteinID: XP_024422395
Position
Unknown
AA seq 77 aa
MNLRLCVQALLLIWLSLTSVCGGPLLQSPSAKGLEEGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgtgtgcaggcgctcctgctgatctggctctccctgacctcggtg
tgtggagggcccctgctgcagtctccttccgcgaagggactggaggaaggcaatgtccgc
cacctggtacagcccagagggtcaagaaatggaccagggccctggcagggaggtcggaga
aaattccgccgccagcggccacgcctctctcataagggccccatgcctttctga

DBGET integrated database retrieval system