KEGG   Desmodus rotundus (common vampire bat): 112311345
Entry
112311345         CDS       T05907                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04114  Oocyte meiosis
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04218  Cellular senescence
dro04270  Vascular smooth muscle contraction
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04540  Gap junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04620  Toll-like receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04730  Long-term depression
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04912  GnRH signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro04929  GnRH secretion
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro05010  Alzheimer disease
dro05034  Alcoholism
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112311345 (MAP2K1)
   04012 ErbB signaling pathway
    112311345 (MAP2K1)
   04014 Ras signaling pathway
    112311345 (MAP2K1)
   04015 Rap1 signaling pathway
    112311345 (MAP2K1)
   04370 VEGF signaling pathway
    112311345 (MAP2K1)
   04371 Apelin signaling pathway
    112311345 (MAP2K1)
   04668 TNF signaling pathway
    112311345 (MAP2K1)
   04066 HIF-1 signaling pathway
    112311345 (MAP2K1)
   04068 FoxO signaling pathway
    112311345 (MAP2K1)
   04072 Phospholipase D signaling pathway
    112311345 (MAP2K1)
   04071 Sphingolipid signaling pathway
    112311345 (MAP2K1)
   04024 cAMP signaling pathway
    112311345 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    112311345 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    112311345 (MAP2K1)
   04150 mTOR signaling pathway
    112311345 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112311345 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112311345 (MAP2K1)
   04210 Apoptosis
    112311345 (MAP2K1)
   04218 Cellular senescence
    112311345 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112311345 (MAP2K1)
   04540 Gap junction
    112311345 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112311345 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112311345 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112311345 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    112311345 (MAP2K1)
   04660 T cell receptor signaling pathway
    112311345 (MAP2K1)
   04662 B cell receptor signaling pathway
    112311345 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    112311345 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    112311345 (MAP2K1)
   04062 Chemokine signaling pathway
    112311345 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112311345 (MAP2K1)
   04929 GnRH secretion
    112311345 (MAP2K1)
   04912 GnRH signaling pathway
    112311345 (MAP2K1)
   04915 Estrogen signaling pathway
    112311345 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    112311345 (MAP2K1)
   04917 Prolactin signaling pathway
    112311345 (MAP2K1)
   04921 Oxytocin signaling pathway
    112311345 (MAP2K1)
   04926 Relaxin signaling pathway
    112311345 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    112311345 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    112311345 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    112311345 (MAP2K1)
   04916 Melanogenesis
    112311345 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112311345 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    112311345 (MAP2K1)
   04726 Serotonergic synapse
    112311345 (MAP2K1)
   04720 Long-term potentiation
    112311345 (MAP2K1)
   04730 Long-term depression
    112311345 (MAP2K1)
   04722 Neurotrophin signaling pathway
    112311345 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112311345 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112311345 (MAP2K1)
   05206 MicroRNAs in cancer
    112311345 (MAP2K1)
   05205 Proteoglycans in cancer
    112311345 (MAP2K1)
   05230 Central carbon metabolism in cancer
    112311345 (MAP2K1)
   05231 Choline metabolism in cancer
    112311345 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112311345 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112311345 (MAP2K1)
   05212 Pancreatic cancer
    112311345 (MAP2K1)
   05225 Hepatocellular carcinoma
    112311345 (MAP2K1)
   05226 Gastric cancer
    112311345 (MAP2K1)
   05214 Glioma
    112311345 (MAP2K1)
   05216 Thyroid cancer
    112311345 (MAP2K1)
   05221 Acute myeloid leukemia
    112311345 (MAP2K1)
   05220 Chronic myeloid leukemia
    112311345 (MAP2K1)
   05218 Melanoma
    112311345 (MAP2K1)
   05211 Renal cell carcinoma
    112311345 (MAP2K1)
   05219 Bladder cancer
    112311345 (MAP2K1)
   05215 Prostate cancer
    112311345 (MAP2K1)
   05213 Endometrial cancer
    112311345 (MAP2K1)
   05224 Breast cancer
    112311345 (MAP2K1)
   05223 Non-small cell lung cancer
    112311345 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112311345 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    112311345 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112311345 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112311345 (MAP2K1)
   05135 Yersinia infection
    112311345 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112311345 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    112311345 (MAP2K1)
   05164 Influenza A
    112311345 (MAP2K1)
   05161 Hepatitis B
    112311345 (MAP2K1)
   05160 Hepatitis C
    112311345 (MAP2K1)
   05163 Human cytomegalovirus infection
    112311345 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112311345 (MAP2K1)
   05165 Human papillomavirus infection
    112311345 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112311345 (MAP2K1)
   01522 Endocrine resistance
    112311345 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112311345 (MAP2K1)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     112311345 (MAP2K1)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: STE group
  STE7 family
   112311345 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 112311345
NCBI-ProteinID: XP_024423444
Position
Unknown
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggccccagacggctccgcggtt
aacgggaccagctcggcagagaccaacctggaggctttgcagaagaagctggaggagctg
gagctcgatgagcagcagcggaagcgccttgaggcctttctgacccagaagcagaaggtg
ggggaactgaaggatgatgactttgagaagatcagcgagctgggtgctggcaatggtggt
gtggtgttcaaggtctcccacaagccatccggcttggttatggccagaaagctgattcac
ctggagatcaaacctgccatccggaaccagatcataagggagctgcaggttctgcatgag
tgtaactccccatacatcgtgggcttctatggtgcattttacagcgatggcgagatcagc
atctgcatggagcacatggatgggggttctttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatatctg
agggagaagcacaagattatgcatagagatgtcaagccttccaacatcctagtgaactcc
cgtggggagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tcagtgcagtcggacatctggagcatggggctctctctggttgagatggcgattgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaggtggag
ggagatgcggctgagacaccacccaggccaaggacccctgggaggccccttagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaacgag
cctcctccgaaactgcccagtggagtattcagtctggaatttcaagatttcgtgaataaa
tgcttaattaaaaaccctgcagagagagcagatttgaagcaactcatggttcatgctttc
atcaagagatctgatgctgaggaagtggattttgcaggttggctctgctccaccattggc
cttaaccagcccagcacgccaacccacgcggctggtgtctaa

KEGG   Desmodus rotundus (common vampire bat): 112312483
Entry
112312483         CDS       T05907                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04218  Cellular senescence
dro04270  Vascular smooth muscle contraction
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04540  Gap junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04620  Toll-like receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04730  Long-term depression
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro05010  Alzheimer disease
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112312483 (MAP2K2)
   04012 ErbB signaling pathway
    112312483 (MAP2K2)
   04014 Ras signaling pathway
    112312483 (MAP2K2)
   04015 Rap1 signaling pathway
    112312483 (MAP2K2)
   04370 VEGF signaling pathway
    112312483 (MAP2K2)
   04371 Apelin signaling pathway
    112312483 (MAP2K2)
   04066 HIF-1 signaling pathway
    112312483 (MAP2K2)
   04068 FoxO signaling pathway
    112312483 (MAP2K2)
   04072 Phospholipase D signaling pathway
    112312483 (MAP2K2)
   04071 Sphingolipid signaling pathway
    112312483 (MAP2K2)
   04024 cAMP signaling pathway
    112312483 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    112312483 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    112312483 (MAP2K2)
   04150 mTOR signaling pathway
    112312483 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112312483 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    112312483 (MAP2K2)
   04218 Cellular senescence
    112312483 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112312483 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    112312483 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112312483 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112312483 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    112312483 (MAP2K2)
   04660 T cell receptor signaling pathway
    112312483 (MAP2K2)
   04662 B cell receptor signaling pathway
    112312483 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    112312483 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112312483 (MAP2K2)
   04929 GnRH secretion
    112312483 (MAP2K2)
   04912 GnRH signaling pathway
    112312483 (MAP2K2)
   04915 Estrogen signaling pathway
    112312483 (MAP2K2)
   04917 Prolactin signaling pathway
    112312483 (MAP2K2)
   04921 Oxytocin signaling pathway
    112312483 (MAP2K2)
   04926 Relaxin signaling pathway
    112312483 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    112312483 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    112312483 (MAP2K2)
   04916 Melanogenesis
    112312483 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112312483 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    112312483 (MAP2K2)
   04730 Long-term depression
    112312483 (MAP2K2)
   04722 Neurotrophin signaling pathway
    112312483 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112312483 (MAP2K2)
   05206 MicroRNAs in cancer
    112312483 (MAP2K2)
   05205 Proteoglycans in cancer
    112312483 (MAP2K2)
   05230 Central carbon metabolism in cancer
    112312483 (MAP2K2)
   05231 Choline metabolism in cancer
    112312483 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112312483 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112312483 (MAP2K2)
   05225 Hepatocellular carcinoma
    112312483 (MAP2K2)
   05226 Gastric cancer
    112312483 (MAP2K2)
   05214 Glioma
    112312483 (MAP2K2)
   05216 Thyroid cancer
    112312483 (MAP2K2)
   05221 Acute myeloid leukemia
    112312483 (MAP2K2)
   05220 Chronic myeloid leukemia
    112312483 (MAP2K2)
   05218 Melanoma
    112312483 (MAP2K2)
   05211 Renal cell carcinoma
    112312483 (MAP2K2)
   05219 Bladder cancer
    112312483 (MAP2K2)
   05215 Prostate cancer
    112312483 (MAP2K2)
   05213 Endometrial cancer
    112312483 (MAP2K2)
   05224 Breast cancer
    112312483 (MAP2K2)
   05223 Non-small cell lung cancer
    112312483 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112312483 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112312483 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112312483 (MAP2K2)
   05135 Yersinia infection
    112312483 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112312483 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    112312483 (MAP2K2)
   05164 Influenza A
    112312483 (MAP2K2)
   05161 Hepatitis B
    112312483 (MAP2K2)
   05160 Hepatitis C
    112312483 (MAP2K2)
   05163 Human cytomegalovirus infection
    112312483 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112312483 (MAP2K2)
   05165 Human papillomavirus infection
    112312483 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112312483 (MAP2K2)
   01522 Endocrine resistance
    112312483 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112312483 (MAP2K2)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     112312483 (MAP2K2)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: STE group
  STE7 family
   112312483 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 112312483
NCBI-ProteinID: XP_024424755
Position
Unknown
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGEPHSISPRPRP
PGRPISGHGVDSRPAMAIFELLDYIVNEPPPKLPSGVFTQDFQEFVNKCLIKNPAERADL
KMLMNHGFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccatcgccgag
ggcccgtcccccactagcgagggcgcctccgaagcaaacttggtggacctccagaagaag
ctagaggagctagagcttgacgagcagcagaagaagcggctagaagccttcctcacccag
aaggccaaggttggggagctcaaggatgatgacttcgaaaggatctcagagctgggagct
gggaatggcggagtcgtcaccaaggtccagcacagaccttcaggcctcatcatggcaaga
aagctgattcacctggagatcaagccggccatccggaaccagatcatccgcgagctgcag
gtgctgcacgagtgtaactccccgtacatcgtgggcttctacggggccttctacagcgac
ggggagatcagcatctgcatggaacacatggatggtggctctttggaccaggtattgaaa
gaagccaagagaattccagaagagatcctggggaaggtcagcatcgcggttcttcggggc
ctggcgtacctgcgggaaaagcaccagatcatgcaccgagatgtgaaaccgtctaacatc
ctcgtcaactccagaggggagatcaagctgtgtgattttggggtgagcgggcagctcatt
gactccatggctaactccttcgtgggaacgcgatcctacatgtctccggagcggttgcaa
ggcactcactactcggtgcagtcggacatctggagcatgggcctgtccctggtggagttg
tccatcggaaggtaccccatccccccgccggacgccaaggagctggaggccatatttggc
cggcccatggtcgatggggcagaaggagagcctcacagcatctcaccgcgcccaagaccc
cccggacgtcccatcagtggtcacggagtggacagccggccagctatggctatcttcgaa
ctgctggactatattgtgaatgagccgcctcctaagcttcccagtggtgtcttcacccag
gacttccaggagtttgtgaataaatgcctcattaagaacccagccgagcgggcagatctg
aagatgctcatgaaccatggcttcatcaaacggtccgaggtagaagaagtggattttgct
ggctggttgtgtaaaacgctgcgtctgaaccagcccagcacgcctacgcgtaccgctgtg
tga

DBGET integrated database retrieval system