KEGG   Desmodus rotundus (common vampire bat): 112311412
Entry
112311412         CDS       T05907                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04024  cAMP signaling pathway
dro04210  Apoptosis
dro04380  Osteoclast differentiation
dro04620  Toll-like receptor signaling pathway
dro04657  IL-17 signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04668  TNF signaling pathway
dro04713  Circadian entrainment
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro04932  Non-alcoholic fatty liver disease
dro04935  Growth hormone synthesis, secretion and action
dro05031  Amphetamine addiction
dro05132  Salmonella infection
dro05133  Pertussis
dro05135  Yersinia infection
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05161  Hepatitis B
dro05162  Measles
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05224  Breast cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05323  Rheumatoid arthritis
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112311412 (FOS)
   04668 TNF signaling pathway
    112311412 (FOS)
   04024 cAMP signaling pathway
    112311412 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112311412 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112311412 (FOS)
   04660 T cell receptor signaling pathway
    112311412 (FOS)
   04658 Th1 and Th2 cell differentiation
    112311412 (FOS)
   04659 Th17 cell differentiation
    112311412 (FOS)
   04657 IL-17 signaling pathway
    112311412 (FOS)
   04662 B cell receptor signaling pathway
    112311412 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    112311412 (FOS)
   04917 Prolactin signaling pathway
    112311412 (FOS)
   04921 Oxytocin signaling pathway
    112311412 (FOS)
   04926 Relaxin signaling pathway
    112311412 (FOS)
   04935 Growth hormone synthesis, secretion and action
    112311412 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    112311412 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    112311412 (FOS)
   04728 Dopaminergic synapse
    112311412 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112311412 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112311412 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112311412 (FOS)
   05231 Choline metabolism in cancer
    112311412 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112311412 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112311412 (FOS)
   05224 Breast cancer
    112311412 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112311412 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    112311412 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112311412 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112311412 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112311412 (FOS)
   05135 Yersinia infection
    112311412 (FOS)
   05133 Pertussis
    112311412 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112311412 (FOS)
   05170 Human immunodeficiency virus 1 infection
    112311412 (FOS)
   05162 Measles
    112311412 (FOS)
   05161 Hepatitis B
    112311412 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112311412 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    112311412 (FOS)
   05142 Chagas disease
    112311412 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112311412 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112311412 (FOS)
   04131 Membrane trafficking [BR:dro04131]
    112311412 (FOS)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    112311412 (FOS)
Membrane trafficking [BR:dro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    112311412 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 112311412
NCBI-ProteinID: XP_024423524
Position
Unknown
AA seq 380 aa
MMFSSFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPYGVPTPSAGAYSRGGVVKTMTGSRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFA
LPLLNDPEPKPSVEPIKNMSNMELKAEPFDDFLFPASARPSGSETARSVPDMDLSGSFYP
ADWEPLHSGSLGMASMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcaagcttcaacgccgactacgaggcatcctcctcccgctgtagtagcgcc
tccccggccggggacagtctttcctactaccactcacctgccgactccttctccagcatg
ggctctcctgtcaatgcgcaggacttttgcacagatctggctgtctccagtgccaacttc
atcccaactgtgactgccatctccaccagcccggacctgcagtggctcgtgcagcccgcc
ctggtctcctccgtggctccatcccagaccagggcccctcacccctatggagtccccacc
ccctcggctggggcttactccagggggggagtcgtgaagaccatgacaggaagcagagct
cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgaaaccggaggagggag
ctgactgacacactccaagcggagacagaccaactagaagacgagaagtctgctttgcag
actgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc
cttgatctgagcggaggcctgcccgaggctgccacccctgagtctgaggaggcctttgcc
ctgcccctcctcaacgaccctgagcccaagccctcagtggagcccatcaaaaacatgagc
aacatggagctgaaggctgagccctttgatgacttcctgttcccagcatcggccaggccc
agcggctcggagaccgcccgctctgtgccagacatggacctgtctggttccttctatcca
gcagactgggagcccctgcacagtggctccctggggatggcgtccatggccacagagctg
gagcccctatgcaccccggtggttacctgtactcccagctgcactacttacacgtcttcc
tttgtcttcacctacccagaggctgactccttccccagctgtgcggctgcccaccgcaag
ggcagcagcagcaacgagccctcctctgactcgctcagctcacccacactgctggccctg
tga

KEGG   Desmodus rotundus (common vampire bat): 112314642
Entry
112314642         CDS       T05907                                 

Gene name
JUN
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04024  cAMP signaling pathway
dro04137  Mitophagy - animal
dro04210  Apoptosis
dro04310  Wnt signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04530  Tight junction
dro04620  Toll-like receptor signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04657  IL-17 signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04668  TNF signaling pathway
dro04722  Neurotrophin signaling pathway
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05132  Salmonella infection
dro05133  Pertussis
dro05135  Yersinia infection
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05161  Hepatitis B
dro05162  Measles
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05224  Breast cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05321  Inflammatory bowel disease
dro05323  Rheumatoid arthritis
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112314642 (JUN)
   04012 ErbB signaling pathway
    112314642 (JUN)
   04310 Wnt signaling pathway
    112314642 (JUN)
   04668 TNF signaling pathway
    112314642 (JUN)
   04024 cAMP signaling pathway
    112314642 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112314642 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    112314642 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112314642 (JUN)
   04530 Tight junction
    112314642 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112314642 (JUN)
   04621 NOD-like receptor signaling pathway
    112314642 (JUN)
   04625 C-type lectin receptor signaling pathway
    112314642 (JUN)
   04660 T cell receptor signaling pathway
    112314642 (JUN)
   04658 Th1 and Th2 cell differentiation
    112314642 (JUN)
   04659 Th17 cell differentiation
    112314642 (JUN)
   04657 IL-17 signaling pathway
    112314642 (JUN)
   04662 B cell receptor signaling pathway
    112314642 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    112314642 (JUN)
   04915 Estrogen signaling pathway
    112314642 (JUN)
   04921 Oxytocin signaling pathway
    112314642 (JUN)
   04926 Relaxin signaling pathway
    112314642 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112314642 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112314642 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112314642 (JUN)
   05203 Viral carcinogenesis
    112314642 (JUN)
   05231 Choline metabolism in cancer
    112314642 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112314642 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112314642 (JUN)
   05211 Renal cell carcinoma
    112314642 (JUN)
   05224 Breast cancer
    112314642 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112314642 (JUN)
   05321 Inflammatory bowel disease
    112314642 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    112314642 (JUN)
   05031 Amphetamine addiction
    112314642 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112314642 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112314642 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112314642 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112314642 (JUN)
   05135 Yersinia infection
    112314642 (JUN)
   05133 Pertussis
    112314642 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112314642 (JUN)
   05170 Human immunodeficiency virus 1 infection
    112314642 (JUN)
   05162 Measles
    112314642 (JUN)
   05161 Hepatitis B
    112314642 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112314642 (JUN)
   05169 Epstein-Barr virus infection
    112314642 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    112314642 (JUN)
   05142 Chagas disease
    112314642 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112314642 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112314642 (JUN)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    112314642 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N TFIIA
Other DBs
NCBI-GeneID: 112314642
NCBI-ProteinID: XP_024427009
Position
Unknown
AA seq 334 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXAQPQQPQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggcgcttacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctagccgatccggtgggcagcctgaagccgcacctccgcgccaagaattcagacctc
ctcacctcgcccgacgtggggctgctcaaactggcgtcgccagagctggagcgcttgatc
attcagtctagcaacgggcacatcaccaccacacctacccccacccagttcctgtgcccc
aagaacgtgactgacgagcaggagggctttgcggagggcttcgtgcgcgcgctggccgaa
ctgcacagccagaacacgctacccagcgtcacgtccgcggcgcagcccgtcagcggggca
ggcatggtggctccggcggtggcttcagtggcgggcggcagcggtagcggcggcttcnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncgcgcagccc
caacagcctcagcagcagccgcctcagccaccgcaccacctgccccagcagatccccgtg
cagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgaaatgcccggg
gagacaccgcccctgtcccctatcgacatggagtcccaagagcggatcaaggcggagagg
aagcgcatgaggaaccgcatcgccgcctccaagtgccggaaaaggaagctggagagaatc
gcccggctggaggaaaaagtgaaaaccttgaaagcgcaaaactcggagctggcgtctaca
gccaacatgcttagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaat
agtgggtgccagctcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system