KEGG   Desmodus rotundus (common vampire bat): 112311423
Entry
112311423         CDS       T05907                                 

Definition
(RefSeq) A-kinase anchor protein 5-like
  KO
K16522  A-kinase anchor protein 5
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112311423
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     112311423
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 112311423
NCBI-ProteinID: XP_024423541
Position
Unknown
AA seq 428 aa
METRVSEIQVESKEEKTSAAGSPQVEKQAEKSSTLCFKRRKKSAKAMKPKASSEVGDVAT
KCPSEAGAPDQPQPLGGTWASIKRLVTRRRRSDSSKQQKPCEAKVQPETHTEDAVLYKKK
AKSRLKVPCLKFSKGEKTSNHSKIIEDADCSIKVQEEDKGSDTKTPTQSDEQATKTKLTQ
DVHGDVSQKEGEEVCESNVSNSRTSPGEKVISVELGLDTGHLAIQTGTLILEKDTETTEE
KDSIQSQQTSPLETSETEHQLPVVSDASPAPATPDQQIVEEARNSTLESVPTWKDHEIGE
IVAEEIKPKDTELGQESDVKEIEISAEKPKTEESRRMEPIAIIITDTEISEFDVKKSKNV
PKQFLISIGNEEVGDFAECGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDE
NKINNLLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagacccgagtttctgagattcaggtggaaagcaaggaagagaagacatcagcagca
ggtagtcctcaggtggagaagcaggcggaaaaatcatcaacactttgcttcaagagaaga
aagaaatcagccaaagcaatgaaacccaaagcgagctctgaagttggtgatgtggcaaca
aaatgtccctcagaagcaggagctcctgatcaaccacagcccctaggggggacctgggcc
tcaatcaaacgccttgtaacacgcaggagaaggtccgattcttcaaagcagcaaaagccc
tgtgaggccaaagtacaacctgaaacccatactgaggatgctgttctttataagaaaaag
gcaaaatccagacttaaggttccctgcctaaaattctcaaaaggggagaaaacaagtaat
cattccaaaattatagaagatgcagactgcagcatcaaagttcaggaagaggataaagga
tcggatacaaaaactccaacccaatcagatgagcaggcaacgaagaccaagctgacccag
gatgtacatggagatgtctcacagaaagaaggtgaggaggtctgtgaatcaaatgtgagc
aacagcagaacttctcctggagagaaggtgatttcagtagaacttgggttagatacaggg
catttggctattcagacaggaactctaatccttgaaaaagatactgaaacgactgaggaa
aaagacagtatccagtcccagcaaacaagcccacttgaaacttcagaaacagaacatcag
ctaccagtagtttctgatgcttcccccgcacctgcaaccccagatcaacaaattgtggaa
gaagccagaaatagtaccctagaaagtgtaccaacctggaaagaccatgaaattggggag
attgtagctgaagagattaagccaaaagatactgaattgggccaggaatcagatgttaaa
gaaatcgagatcagtgcagagaaacccaaaacagaagaaagcagaagaatggagccaatt
gctattattattacagacactgaaattagtgaatttgatgttaaaaaatctaaaaatgtc
cctaagcagttcttaatttcaattggaaatgaagaagtaggggattttgctgagtgtggt
tttgagggtagaacttcagaacaatatgaaacactattaatagaaaccgcttcttctctt
gtcaagaacgctatccagttgtctatagaacagctggttaatgaaatggcctccgatgag
aataaaataaacaatcttctacagtga

DBGET integrated database retrieval system