KEGG   Desmodus rotundus (common vampire bat): 112311458
Entry
112311458         CDS       T05907                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04261  Adrenergic signaling in cardiomyocytes
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04910  Insulin signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04920  Adipocytokine signaling pathway
dro04922  Glucagon signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05017  Spinocerebellar ataxia
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05142  Chagas disease
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112311458 (AKT1)
   04012 ErbB signaling pathway
    112311458 (AKT1)
   04014 Ras signaling pathway
    112311458 (AKT1)
   04015 Rap1 signaling pathway
    112311458 (AKT1)
   04370 VEGF signaling pathway
    112311458 (AKT1)
   04371 Apelin signaling pathway
    112311458 (AKT1)
   04630 JAK-STAT signaling pathway
    112311458 (AKT1)
   04668 TNF signaling pathway
    112311458 (AKT1)
   04066 HIF-1 signaling pathway
    112311458 (AKT1)
   04068 FoxO signaling pathway
    112311458 (AKT1)
   04072 Phospholipase D signaling pathway
    112311458 (AKT1)
   04071 Sphingolipid signaling pathway
    112311458 (AKT1)
   04024 cAMP signaling pathway
    112311458 (AKT1)
   04022 cGMP-PKG signaling pathway
    112311458 (AKT1)
   04151 PI3K-Akt signaling pathway
    112311458 (AKT1)
   04152 AMPK signaling pathway
    112311458 (AKT1)
   04150 mTOR signaling pathway
    112311458 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112311458 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    112311458 (AKT1)
   04218 Cellular senescence
    112311458 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112311458 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112311458 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112311458 (AKT1)
   04620 Toll-like receptor signaling pathway
    112311458 (AKT1)
   04625 C-type lectin receptor signaling pathway
    112311458 (AKT1)
   04660 T cell receptor signaling pathway
    112311458 (AKT1)
   04662 B cell receptor signaling pathway
    112311458 (AKT1)
   04664 Fc epsilon RI signaling pathway
    112311458 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    112311458 (AKT1)
   04062 Chemokine signaling pathway
    112311458 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112311458 (AKT1)
   04922 Glucagon signaling pathway
    112311458 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    112311458 (AKT1)
   04920 Adipocytokine signaling pathway
    112311458 (AKT1)
   04929 GnRH secretion
    112311458 (AKT1)
   04915 Estrogen signaling pathway
    112311458 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    112311458 (AKT1)
   04917 Prolactin signaling pathway
    112311458 (AKT1)
   04926 Relaxin signaling pathway
    112311458 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    112311458 (AKT1)
   04919 Thyroid hormone signaling pathway
    112311458 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112311458 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112311458 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    112311458 (AKT1)
   04728 Dopaminergic synapse
    112311458 (AKT1)
   04722 Neurotrophin signaling pathway
    112311458 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112311458 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    112311458 (AKT1)
   04213 Longevity regulating pathway - multiple species
    112311458 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112311458 (AKT1)
   05205 Proteoglycans in cancer
    112311458 (AKT1)
   05230 Central carbon metabolism in cancer
    112311458 (AKT1)
   05231 Choline metabolism in cancer
    112311458 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112311458 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112311458 (AKT1)
   05212 Pancreatic cancer
    112311458 (AKT1)
   05225 Hepatocellular carcinoma
    112311458 (AKT1)
   05226 Gastric cancer
    112311458 (AKT1)
   05214 Glioma
    112311458 (AKT1)
   05221 Acute myeloid leukemia
    112311458 (AKT1)
   05220 Chronic myeloid leukemia
    112311458 (AKT1)
   05218 Melanoma
    112311458 (AKT1)
   05211 Renal cell carcinoma
    112311458 (AKT1)
   05215 Prostate cancer
    112311458 (AKT1)
   05213 Endometrial cancer
    112311458 (AKT1)
   05224 Breast cancer
    112311458 (AKT1)
   05222 Small cell lung cancer
    112311458 (AKT1)
   05223 Non-small cell lung cancer
    112311458 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112311458 (AKT1)
   05017 Spinocerebellar ataxia
    112311458 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112311458 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112311458 (AKT1)
   04931 Insulin resistance
    112311458 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112311458 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112311458 (AKT1)
   05135 Yersinia infection
    112311458 (AKT1)
   05152 Tuberculosis
    112311458 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112311458 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    112311458 (AKT1)
   05162 Measles
    112311458 (AKT1)
   05164 Influenza A
    112311458 (AKT1)
   05161 Hepatitis B
    112311458 (AKT1)
   05160 Hepatitis C
    112311458 (AKT1)
   05168 Herpes simplex virus 1 infection
    112311458 (AKT1)
   05163 Human cytomegalovirus infection
    112311458 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112311458 (AKT1)
   05169 Epstein-Barr virus infection
    112311458 (AKT1)
   05165 Human papillomavirus infection
    112311458 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112311458 (AKT1)
   05142 Chagas disease
    112311458 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112311458 (AKT1)
   01524 Platinum drug resistance
    112311458 (AKT1)
   01522 Endocrine resistance
    112311458 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112311458 (AKT1)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112311458 (AKT1)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112311458 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 112311458
NCBI-ProteinID: XP_024423582
Position
Unknown
AA seq 480 aa
MTDGAVVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHVKITDFGLCKEGI
KDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKALLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQEDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaccgacggggcggttgtcaaggagggctggctgcacaagcgaggggagtacatcaaa
acctggcggccccgctacttcctgctcaagaacgacggcaccttcatcggctacaaggaa
cggccgcaggacgtggagcagcgcgagtcacccctcaacaacttctctgtggcacaatgc
cagctgatgaagacagagcggcctcggcccaacaccttcatcatccggtgcctgcagtgg
accacggtcatcgagcgtaccttccacgtggagactcccgaggagcgggaagagtggacc
actgccatccagacggtggccgacgggctcaagcggcaggaggaggagatgatggacttc
cgatcgggctcgcctagcgacaactcgggggctgaggagatggaggtgtccctggccaag
cccaagcaccgtgtgaccatgaacgagttcgagtacctgaagctgctgggcaagggcacc
ttcgggaaggtgatcctggtgaaggaaaaagccacgggccgctactacgccatgaagatc
ctcaagaaggaggtcatcgtggccaaggacgaggtggcacacacgctcacggagaaccgc
gtgctgcagaactcccggcaccccttcctgacggccctgaagtactccttccagacccac
gaccgcctctgctttgtcatggagtacgccaacggtggcgagctcttcttccacctgtca
cgggagcgggtgttcccggaggaccgcgcacgcttctatggcgcagagatcgtgtcggcc
ctggactacctgcactcagagaagaacgtcgtctaccgagacctcaagctggagaacctg
atgctggacaaggacgggcacgtcaagatcacggacttcgggctgtgcaaggagggcatc
aaggatggggccaccatgaggaccttctgcgggacgcccgagtacctggcgcccgaggtg
ctggaagacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatgtac
gagatgctgtgtggccggctgcccttctacaaccaggaccacgagaagctcttcgagctc
atcctcatggaggagatccgcttcccacgcacgctcagccccgaggccaaggccctgctg
tccgggctgctcaagaaggaccccaagcagaggcttggagggggctccgaggacgccaag
gagatcatgcagcaccgcttcttcgccagcatcgtgtggcaggacgtgtatgagaagaag
ctcagtccgcccttcaagccccaggtcacctcggagacagacaccaggtattttgacgag
gagttcaccgcccagatgatcaccatcaccccacccgaccaagaggacagcatggagtgt
gtggacagcgagaggaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Desmodus rotundus (common vampire bat): 112318919
Entry
112318919         CDS       T05907                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04261  Adrenergic signaling in cardiomyocytes
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04910  Insulin signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04920  Adipocytokine signaling pathway
dro04922  Glucagon signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05017  Spinocerebellar ataxia
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05142  Chagas disease
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112318919 (AKT3)
   04012 ErbB signaling pathway
    112318919 (AKT3)
   04014 Ras signaling pathway
    112318919 (AKT3)
   04015 Rap1 signaling pathway
    112318919 (AKT3)
   04370 VEGF signaling pathway
    112318919 (AKT3)
   04371 Apelin signaling pathway
    112318919 (AKT3)
   04630 JAK-STAT signaling pathway
    112318919 (AKT3)
   04668 TNF signaling pathway
    112318919 (AKT3)
   04066 HIF-1 signaling pathway
    112318919 (AKT3)
   04068 FoxO signaling pathway
    112318919 (AKT3)
   04072 Phospholipase D signaling pathway
    112318919 (AKT3)
   04071 Sphingolipid signaling pathway
    112318919 (AKT3)
   04024 cAMP signaling pathway
    112318919 (AKT3)
   04022 cGMP-PKG signaling pathway
    112318919 (AKT3)
   04151 PI3K-Akt signaling pathway
    112318919 (AKT3)
   04152 AMPK signaling pathway
    112318919 (AKT3)
   04150 mTOR signaling pathway
    112318919 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112318919 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    112318919 (AKT3)
   04218 Cellular senescence
    112318919 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112318919 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    112318919 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112318919 (AKT3)
   04620 Toll-like receptor signaling pathway
    112318919 (AKT3)
   04625 C-type lectin receptor signaling pathway
    112318919 (AKT3)
   04660 T cell receptor signaling pathway
    112318919 (AKT3)
   04662 B cell receptor signaling pathway
    112318919 (AKT3)
   04664 Fc epsilon RI signaling pathway
    112318919 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    112318919 (AKT3)
   04062 Chemokine signaling pathway
    112318919 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112318919 (AKT3)
   04922 Glucagon signaling pathway
    112318919 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    112318919 (AKT3)
   04920 Adipocytokine signaling pathway
    112318919 (AKT3)
   04929 GnRH secretion
    112318919 (AKT3)
   04915 Estrogen signaling pathway
    112318919 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    112318919 (AKT3)
   04917 Prolactin signaling pathway
    112318919 (AKT3)
   04926 Relaxin signaling pathway
    112318919 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    112318919 (AKT3)
   04919 Thyroid hormone signaling pathway
    112318919 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112318919 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112318919 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    112318919 (AKT3)
   04728 Dopaminergic synapse
    112318919 (AKT3)
   04722 Neurotrophin signaling pathway
    112318919 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112318919 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    112318919 (AKT3)
   04213 Longevity regulating pathway - multiple species
    112318919 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112318919 (AKT3)
   05205 Proteoglycans in cancer
    112318919 (AKT3)
   05230 Central carbon metabolism in cancer
    112318919 (AKT3)
   05231 Choline metabolism in cancer
    112318919 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112318919 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112318919 (AKT3)
   05212 Pancreatic cancer
    112318919 (AKT3)
   05225 Hepatocellular carcinoma
    112318919 (AKT3)
   05226 Gastric cancer
    112318919 (AKT3)
   05214 Glioma
    112318919 (AKT3)
   05221 Acute myeloid leukemia
    112318919 (AKT3)
   05220 Chronic myeloid leukemia
    112318919 (AKT3)
   05218 Melanoma
    112318919 (AKT3)
   05211 Renal cell carcinoma
    112318919 (AKT3)
   05215 Prostate cancer
    112318919 (AKT3)
   05213 Endometrial cancer
    112318919 (AKT3)
   05224 Breast cancer
    112318919 (AKT3)
   05222 Small cell lung cancer
    112318919 (AKT3)
   05223 Non-small cell lung cancer
    112318919 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112318919 (AKT3)
   05017 Spinocerebellar ataxia
    112318919 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112318919 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112318919 (AKT3)
   04931 Insulin resistance
    112318919 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112318919 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112318919 (AKT3)
   05135 Yersinia infection
    112318919 (AKT3)
   05152 Tuberculosis
    112318919 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112318919 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    112318919 (AKT3)
   05162 Measles
    112318919 (AKT3)
   05164 Influenza A
    112318919 (AKT3)
   05161 Hepatitis B
    112318919 (AKT3)
   05160 Hepatitis C
    112318919 (AKT3)
   05168 Herpes simplex virus 1 infection
    112318919 (AKT3)
   05163 Human cytomegalovirus infection
    112318919 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112318919 (AKT3)
   05169 Epstein-Barr virus infection
    112318919 (AKT3)
   05165 Human papillomavirus infection
    112318919 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112318919 (AKT3)
   05142 Chagas disease
    112318919 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112318919 (AKT3)
   01524 Platinum drug resistance
    112318919 (AKT3)
   01522 Endocrine resistance
    112318919 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112318919 (AKT3)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112318919 (AKT3)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112318919 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 112318919
NCBI-ProteinID: XP_024431926
Position
Unknown
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccatcgtgaaggaaggctgggtgcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaagag
aaaccacaagacgtggatttaccttatcccctcaacaacttctcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgcctccagtggacc
actgttatagagagaacatttcacgtggatacgccagaggagagggaggaatggacagaa
gctattcaggcggtggcagacagacttcagaggcaggaggaggagagaatgaactgcagt
ccgacttcacagattgataacatcggggaggaagagatggatgcgtctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtgggaaatactatgctatgaagattctgaag
aaagaagttattattgcaaaggatgaggtggcacacactctcacagaaagcagagtatta
aagaacactagacacccctttttaacgtccttgaaatattccttccagactaaggaccga
ttgtgttttgtgatggaatatgttaatggaggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctacggcgcggagattgtctctgccttggac
tacctgcactccgggaagattgtgtaccgcgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaattacagattttgggctttgcaaagaagggatcacagacgca
gccacgatgaagacgttctgtgggacaccggagtacctggccccggaggtgttggaggac
aacgactacggccgggccgtggattggtggggcctgggtgtcgtcatgtatgagatgatg
tgcggaaggctccctttctacaaccaggaccacgagaaacttttcgaactgatactgatg
gaagacatcaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggcggagggccagatgatgcaaaagaaattatg
agacacagtttcttctccggagtaaactggcaagatgtatacgataaaaagcttgtaccg
ccttttaagcctcaagtaacatctgagacagacaccagatattttgatgaagaatttaca
gctcagactattaccataacaccacctgaaaaatatgacgaggacggcatggactgcgtg
gacaacgagcggcggccgcacttccctcagttctcctactcagccagtggacgcgaataa

KEGG   Desmodus rotundus (common vampire bat): 112320130
Entry
112320130         CDS       T05907                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04261  Adrenergic signaling in cardiomyocytes
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04910  Insulin signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04920  Adipocytokine signaling pathway
dro04922  Glucagon signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05017  Spinocerebellar ataxia
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05142  Chagas disease
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112320130 (AKT2)
   04012 ErbB signaling pathway
    112320130 (AKT2)
   04014 Ras signaling pathway
    112320130 (AKT2)
   04015 Rap1 signaling pathway
    112320130 (AKT2)
   04370 VEGF signaling pathway
    112320130 (AKT2)
   04371 Apelin signaling pathway
    112320130 (AKT2)
   04630 JAK-STAT signaling pathway
    112320130 (AKT2)
   04668 TNF signaling pathway
    112320130 (AKT2)
   04066 HIF-1 signaling pathway
    112320130 (AKT2)
   04068 FoxO signaling pathway
    112320130 (AKT2)
   04072 Phospholipase D signaling pathway
    112320130 (AKT2)
   04071 Sphingolipid signaling pathway
    112320130 (AKT2)
   04024 cAMP signaling pathway
    112320130 (AKT2)
   04022 cGMP-PKG signaling pathway
    112320130 (AKT2)
   04151 PI3K-Akt signaling pathway
    112320130 (AKT2)
   04152 AMPK signaling pathway
    112320130 (AKT2)
   04150 mTOR signaling pathway
    112320130 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112320130 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    112320130 (AKT2)
   04218 Cellular senescence
    112320130 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112320130 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    112320130 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112320130 (AKT2)
   04620 Toll-like receptor signaling pathway
    112320130 (AKT2)
   04625 C-type lectin receptor signaling pathway
    112320130 (AKT2)
   04660 T cell receptor signaling pathway
    112320130 (AKT2)
   04662 B cell receptor signaling pathway
    112320130 (AKT2)
   04664 Fc epsilon RI signaling pathway
    112320130 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    112320130 (AKT2)
   04062 Chemokine signaling pathway
    112320130 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112320130 (AKT2)
   04922 Glucagon signaling pathway
    112320130 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    112320130 (AKT2)
   04920 Adipocytokine signaling pathway
    112320130 (AKT2)
   04929 GnRH secretion
    112320130 (AKT2)
   04915 Estrogen signaling pathway
    112320130 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    112320130 (AKT2)
   04917 Prolactin signaling pathway
    112320130 (AKT2)
   04926 Relaxin signaling pathway
    112320130 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    112320130 (AKT2)
   04919 Thyroid hormone signaling pathway
    112320130 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112320130 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112320130 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    112320130 (AKT2)
   04728 Dopaminergic synapse
    112320130 (AKT2)
   04722 Neurotrophin signaling pathway
    112320130 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112320130 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    112320130 (AKT2)
   04213 Longevity regulating pathway - multiple species
    112320130 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112320130 (AKT2)
   05205 Proteoglycans in cancer
    112320130 (AKT2)
   05230 Central carbon metabolism in cancer
    112320130 (AKT2)
   05231 Choline metabolism in cancer
    112320130 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112320130 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112320130 (AKT2)
   05212 Pancreatic cancer
    112320130 (AKT2)
   05225 Hepatocellular carcinoma
    112320130 (AKT2)
   05226 Gastric cancer
    112320130 (AKT2)
   05214 Glioma
    112320130 (AKT2)
   05221 Acute myeloid leukemia
    112320130 (AKT2)
   05220 Chronic myeloid leukemia
    112320130 (AKT2)
   05218 Melanoma
    112320130 (AKT2)
   05211 Renal cell carcinoma
    112320130 (AKT2)
   05215 Prostate cancer
    112320130 (AKT2)
   05213 Endometrial cancer
    112320130 (AKT2)
   05224 Breast cancer
    112320130 (AKT2)
   05222 Small cell lung cancer
    112320130 (AKT2)
   05223 Non-small cell lung cancer
    112320130 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112320130 (AKT2)
   05017 Spinocerebellar ataxia
    112320130 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112320130 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112320130 (AKT2)
   04931 Insulin resistance
    112320130 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112320130 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112320130 (AKT2)
   05135 Yersinia infection
    112320130 (AKT2)
   05152 Tuberculosis
    112320130 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112320130 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    112320130 (AKT2)
   05162 Measles
    112320130 (AKT2)
   05164 Influenza A
    112320130 (AKT2)
   05161 Hepatitis B
    112320130 (AKT2)
   05160 Hepatitis C
    112320130 (AKT2)
   05168 Herpes simplex virus 1 infection
    112320130 (AKT2)
   05163 Human cytomegalovirus infection
    112320130 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112320130 (AKT2)
   05169 Epstein-Barr virus infection
    112320130 (AKT2)
   05165 Human papillomavirus infection
    112320130 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112320130 (AKT2)
   05142 Chagas disease
    112320130 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112320130 (AKT2)
   01524 Platinum drug resistance
    112320130 (AKT2)
   01522 Endocrine resistance
    112320130 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112320130 (AKT2)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112320130 (AKT2)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112320130 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 112320130
NCBI-ProteinID: XP_024433328
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMQAIQMVANSLKQRGLGEDSM
DYKCGSPSDSSAAEEMEVSVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLPPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLDLDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtctctgtcatcaaagaaggctggcttcacaagcgtggtgaatacatcaag
acctggaggccccggtacttcctgctgaagagtgatggctccttcattggctataaggag
cgacccgaggcacctgaccagactctgcctcccctaaacaacttctctgttgcagaatgc
cagctgatgaagaccgagagaccacggcccaacacgtttgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtagactctccagatgagagggaggagtggatg
caggccatccagatggtcgccaacagcctcaagcagcgtggcctgggtgaggactccatg
gactacaagtgtggctcccctagtgactcttcggcggccgaggagatggaagtgtcagtt
agcaaagcgcgggccaaggtgaccatgaatgacttcgactatctcaagctgctcggcaag
ggcacctttggcaaagtcatcctggtgcgggagaaggccaccggccgctactatgccatg
aagatcctgcggaaggaggtgatcatcgccaaggatgaagtcgcccacacggtcactgag
agccgggttctccagaacaccaggcacccgttcctcaccgcgctgaagtatgccttccag
acccatgaccgcctgtgctttgtgatggagtacgccaatggtggggagctgttcttccac
ctgtccagggagcgtgtcttcacagaggagagggcccgcttctatggcgcagagatcgtc
tcagccctggagtacctgcactcgagggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggataaagatggccacatcaagatcaccgactttggcctgtgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgcgggacccccgagtatctggcgcctgag
gtgctggaggacaacgactacggccgggctgtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcattctcatggaggagatccgcttcccgcgcacactcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagtgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggatgtggtacagaag
aagctcccaccacccttcaaacctcaggtcacgtctgaggtcgacacgaggtacttcgac
gacgagttcactgcccagtccatcacgatcacacccccggaccgctatgacagcttgggc
tcgcttgacctggaccagcggactcacttcccccagttctcctactcggccagcatccga
gagtga

DBGET integrated database retrieval system