KEGG   Desmodus rotundus (common vampire bat): 112311539Help
Entry
112311539         CDS       T05907                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00564  Glycerophospholipid metabolism
dro00565  Ether lipid metabolism
dro00590  Arachidonic acid metabolism
dro00591  Linoleic acid metabolism
dro00592  alpha-Linolenic acid metabolism
dro01100  Metabolic pathways
dro04010  MAPK signaling pathway
dro04014  Ras signaling pathway
dro04072  Phospholipase D signaling pathway
dro04217  Necroptosis
dro04270  Vascular smooth muscle contraction
dro04370  VEGF signaling pathway
dro04611  Platelet activation
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04724  Glutamatergic synapse
dro04726  Serotonergic synapse
dro04730  Long-term depression
dro04750  Inflammatory mediator regulation of TRP channels
dro04912  GnRH signaling pathway
dro04913  Ovarian steroidogenesis
dro04921  Oxytocin signaling pathway
dro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    112311539 (PLA2G4F)
   00565 Ether lipid metabolism
    112311539 (PLA2G4F)
   00590 Arachidonic acid metabolism
    112311539 (PLA2G4F)
   00591 Linoleic acid metabolism
    112311539 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    112311539 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112311539 (PLA2G4F)
   04010 MAPK signaling pathway
    112311539 (PLA2G4F)
   04370 VEGF signaling pathway
    112311539 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    112311539 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112311539 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112311539 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    112311539 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    112311539 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    112311539 (PLA2G4F)
   04913 Ovarian steroidogenesis
    112311539 (PLA2G4F)
   04921 Oxytocin signaling pathway
    112311539 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112311539 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    112311539 (PLA2G4F)
   04726 Serotonergic synapse
    112311539 (PLA2G4F)
   04730 Long-term depression
    112311539 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112311539 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    112311539 (PLA2G4F)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     112311539 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 112311539
NCBI-ProteinID: XP_024423700
Position
Unknown
AA seq 849 aa AA seqDB search
MLWALWPRWPASKGLPVLGVVWLRRRENRAPQWSHWRRETHPYYDLQVKVLRARNIRGSD
LLSKADCYVQLWLPTASPSRAQTRVIANCSDPEWNETFHYRIHGAVKNVLELTLYDKDIV
GSDELSMLLFDLKSLKPGQPHRHTFPLNQQDSQELQVEFVLEKSQVPASEVITNGVLVAQ
PCLRIQGTLGGDETAPRGKYGSRQVRLAVPGAYEKPQLLPLQPPMEASPPATFTFHVNPV
LRSRLDVELAEKLTILQSGPSAELEAQNSNLGEGSILLSSLTLGQEKQCLVALGEGQEVA
LSVKAEMSSGDLDLRLGFDLCDGEREFLDKRKQIVSKALQRVLGLSQAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLSALQELSLLDTVTYLSGVSGSTWCISTLYKDPAWSQVALQGPTE
RARARVCSSKVGAVSTERLQYYAQELGNLENNGHSVSLIDLWGLLIEYFLYEEENPAKLS
DQQEAVSQSQNPYPIYAGVNVRTNISGEDFSEWCEFTPYEVGFPKYGAYVPTKLFGSEFF
MGRLLRFWPEPRICYLQGMWGSAFAASLDEIFQKTTGFSLSFLDWLRGCVNITDDYQKLQ
LHDPTRLRTRLFTPQGPFSQALLDIFTSRFTSAESFNFTRGLCLHKDYVACREFVAWKDT
HPDAFPNWLTPMRDCLSLVDGGFAINSPFPLSLLPQRAVDLIVSFDYSLDAPFEVLQMTE
KYCLDRGIPFPKIEVLPEDLEEPHECYLFAMAEDPRSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFDINGPDTPYGMMNFTYEPEEFDRLVALSRYNVLNNVETIKQALQLALDR
QRTGARAGG
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcactctggcccaggtggccagcaagcaaggggctgcctgtcctgggcgtg
gtgtggctgcgaaggagagagaacagggcacctcagtggagtcactggcggcgggaaacc
cacccatactacgacctccaggtgaaggtgctgagggccagaaatatccggggctcagac
ctgttgtccaaagccgactgctacgtgcagctgtggctgcccacagcctctcccagccgc
gcccagacaagggtgatagccaattgcagtgaccctgagtggaatgagaccttccactac
cggatacatggtgctgtgaagaatgttctggagctcaccctctatgacaaggacatcgtg
ggcagtgatgaactctccatgctgctgtttgacctgaaaagcctcaagcctggccaaccc
cacagacacaccttcccactcaaccagcaggattcacaagagctgcaggtggagtttgtt
ctggagaagagccaggtgcctgcgtctgaagtcatcaccaatggtgtcctggtggctcag
ccctgtctgaggatccagggcaccctcgggggagatgagactgctccacgtggaaagtat
ggctctaggcaggttcggctggcagtgcccggggcctacgagaaaccacagctcttgccc
ctgcagcctcccatggaggcaagccccccagccacctttaccttccatgtgaacccggtg
cttcgctccaggctggatgtggaactggcggagaagctcaccatcctgcagagtggcccg
agtgctgagttggaggctcagaacagcaacctgggtgaggggagcatcctgctctcctct
ttgaccctaggtcaggagaaacagtgcttggtggctctgggggagggccaggaggtggct
ctgagtgtgaaggcagaaatgagctctggggaccttgacctgcgccttggctttgacctc
tgtgatggggagcgagagtttctggacaagaggaagcagattgtgtccaaagccctgcag
cgggtgctgggattgagccaggctcctgacagtggccaggtgcctgtggtggctgtgctg
ggctctggaggtgggacccgtgccatgtcctccctgtacggcagcctgtcagcgctgcag
gagctcagcctcctggacactgtgacctacctgagtggggtctctgggtccacctggtgc
atctccacactgtacaaggacccagcctggtcccaggtggccttgcagggccccaccgag
cgtgcccgggcccgggtctgcagcagtaaggtgggcgcagtgtccacggaacgcctacaa
tactacgctcaggaactggggaaccttgaaaacaatggtcatagcgtttccctcattgac
ctctggggcctcctcattgagtatttcctgtacgaggaggaaaaccctgccaaactctct
gaccagcaggaggccgtgagccagagccagaacccttatcccatctatgctggtgtcaac
gtccgcaccaacatcagcggggaagacttctcagagtggtgcgagtttaccccctacgag
gttggcttccccaagtatggggcttacgttcccaccaagctctttggctcagagttcttc
atggggcgactgctgaggttctggccagagcctcggatctgctacctgcagggtatgtgg
ggcagcgcctttgcagccagcctggatgagatcttccagaagaccaccggcttcagcctc
agcttcctggactggctccgaggctgtgtgaacatcacagacgactaccagaagcttcag
ctgcacgaccccacaaggctgcgaacgaggctcttcaccccccaggggcccttctcccag
gctctactagacatattcacctcacgctttacctccgcggagagtttcaacttcacccgg
ggcctctgtctgcacaaggactatgtggcctgcagggagttcgtggcctggaaagacact
cacccggacgccttccccaactggctcactcccatgcgggactgcctgtccctggtggat
ggcggcttcgccatcaactctcccttcccgctgagcctgctgccgcagagagcggtggac
ctcattgtgtccttcgactactccctggatgcaccttttgaggtcttacagatgacagag
aagtactgcctggaccgaggcatccccttccccaaaatcgaggtgctccctgaggacctg
gaggaaccccatgagtgctacctgtttgccatggctgaggacccccgctctcccattgtg
ctgcacttccccctggtcaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgacatcaacgggccagacaccccctat
ggcatgatgaactttacctatgagcccgaggagtttgatcggctggtggccctgagtcga
tacaacgttctgaacaatgtagagaccatcaagcaggccctccagctggctctagaccgg
caacggactggggcccgggctggaggctga

DBGET integrated database retrieval system