KEGG   Desmodus rotundus (common vampire bat): 112312435Help
Entry
112312435         CDS       T05907                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04012  ErbB signaling pathway
dro04020  Calcium signaling pathway
dro04024  cAMP signaling pathway
dro04066  HIF-1 signaling pathway
dro04114  Oocyte meiosis
dro04217  Necroptosis
dro04261  Adrenergic signaling in cardiomyocytes
dro04310  Wnt signaling pathway
dro04360  Axon guidance
dro04713  Circadian entrainment
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04740  Olfactory transduction
dro04750  Inflammatory mediator regulation of TRP channels
dro04911  Insulin secretion
dro04912  GnRH signaling pathway
dro04916  Melanogenesis
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04934  Cushing syndrome
dro04971  Gastric acid secretion
dro05031  Amphetamine addiction
dro05152  Tuberculosis
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05214  Glioma
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112312435 (CAMK2D)
   04310 Wnt signaling pathway
    112312435 (CAMK2D)
   04066 HIF-1 signaling pathway
    112312435 (CAMK2D)
   04020 Calcium signaling pathway
    112312435 (CAMK2D)
   04024 cAMP signaling pathway
    112312435 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112312435 (CAMK2D)
   04217 Necroptosis
    112312435 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112312435 (CAMK2D)
   04922 Glucagon signaling pathway
    112312435 (CAMK2D)
   04912 GnRH signaling pathway
    112312435 (CAMK2D)
   04921 Oxytocin signaling pathway
    112312435 (CAMK2D)
   04916 Melanogenesis
    112312435 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    112312435 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112312435 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    112312435 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    112312435 (CAMK2D)
   04728 Dopaminergic synapse
    112312435 (CAMK2D)
   04720 Long-term potentiation
    112312435 (CAMK2D)
   04722 Neurotrophin signaling pathway
    112312435 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    112312435 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    112312435 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    112312435 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112312435 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112312435 (CAMK2D)
   05205 Proteoglycans in cancer
    112312435 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    112312435 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    112312435 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112312435 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112312435 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112312435 (CAMK2D)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     112312435 (CAMK2D)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   112312435 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Motif
Other DBs
NCBI-GeneID: 112312435
NCBI-ProteinID: XP_024424680
Position
Unknown
AA seq 512 aa AA seqDB search
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENAPPPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALG
NLVEGMDFHRFYFENALSKSSKPVHTIILNPHVHLVGEDAACIAYVRLTQYLDGGGLPRT
MQSEETRVWHRRDGKWQNVHFHRSGSPTVPTN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaccaccacctgcacccggttcacggacgagtaccagctcttcgaggagctc
ggaaagggggctttttcggtggtgagaagatgtatgaaaatccctactggtcaagaatat
gctgccaaaatcatcaacaccaagaagctttctgccagggatcatcagaaactagaaagg
gaagctagaatctgccgtctgctgaagcaccccaatattgtgcggctgcacgacagcata
tcggaagaaggcttccactacctggtgtttgacctagttactgggggtgaactgtttgaa
gacattgtggcgagagaatactacagcgaggctgatgccagtcactgcatacagcagatt
ctagaaagtgtaaatcattgtcacctgaatggcatagtgcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcggctgtgaagctggcggactttggcctg
gccatagaagttcaaggagaccagcaggcatggtttgggttcgcgggcacgcccggctac
ctctctccagaggtcctacggaaggacccctatgggaagccagtggacatgtgggcctgc
ggtgtcattctgtacattctgctggtggggtaccccccgttctgggacgaagaccagcac
aggctctaccagcagatcaaggccggcgcttatgactttccatccccagagtgggacaca
gtgactcctgaagccaaagacctcatcaacaagatgctgaccatcaaccccgccaagcgc
atcaccgcctccgaggcgctcaagcacccctggatctgccaacgctccacggtggcctcc
atgatgcacaggcaggagacggtagactgcctgaagaagttcaatgcccgcaggaagctc
aagggcgccatcctgacaacgatgctggccacgaggaatttctcagcagccaagagtttg
ctgaagaaaccagacggagtgaagataaacaacaaagccaacgtggtaactagccccaaa
gaaaatgcccctcccccggcgctggagccccaaaccactgtaatccacaaccctgacgga
aacaaggagtccacagagagctccaacaccacgatcgaggacgaggacgtgaaagcccgg
aagcaagagatcatcaaagtcactgagcagctgattgaagccatcaacaacggagacttt
gaagcatacacaaaaatctgtgaccccggccttactgcctttgaacctgaagctttgggc
aatttagtggaaggaatggacttccatcgattctactttgaaaatgctttgtccaagagc
agcaagccggtgcacaccatcatcctgaacccccacgtgcacctggtgggcgaggatgcc
gcgtgcatcgcctacgtgcggctcacccagtacctggacggcggcggcctgcccaggacc
atgcagtccgaggagactcgcgtgtggcaccgccgggacggcaagtggcagaacgtgcac
ttccatcgctcggggtcacccacggtgcccaccaactaa

DBGET integrated database retrieval system