KEGG   Desmodus rotundus (common vampire bat): 112312670Help
Entry
112312670         CDS       T05907                                 

Gene name
TDO2
Definition
(RefSeq) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00380  Tryptophan metabolism
dro01100  Metabolic pathways
Module
dro_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    112312670 (TDO2)
Enzymes [BR:dro01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     112312670 (TDO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_dioxygenase DUF3107
Motif
Other DBs
NCBI-GeneID: 112312670
NCBI-ProteinID: XP_024425020
Position
Unknown
AA seq 406 aa AA seqDB search
MSGCPFLRNGLRHSFEKLSLEGSEEDESQTGINKASKGGLIYGNYLHLEKILKAQELQSE
IKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGLVRDERNMLKVVTRMHRVVV
ILKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSSRVPYNRRHY
RDNFKGEDNELLLQSEQEKTLLQLVEAWLERTPGLEPQGFNFWGKLETNIVKGLEEEFTM
IQTKKESEEKEEQIAEFQKQKDVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE
EPRFQVPFQLLTSLMDIDTLLTKWRYNHVCLVHRMLGSKAGTGGSSGYHYLRSTVSDRYK
VFVDLFNLSTYLVPRHWIPKMNPGVHKFLYTAKYCDSSYFSSEESD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctgtccgtttttaagaaatggccttaggcattcttttgaaaaactatcttta
gaaggcagtgaagaagatgaatcacaaactggtataaataaagccagcaaaggaggactt
atctatgggaattatcttcatttggaaaaaattttgaaggcacaggagcttcaaagtgaa
ataaaaggaaataaaatccacgacgaacaccttttcatcataactcatcaagcttatgaa
ctctggtttaagcaaatcctctgggaattagattctgttcgtgagatctttcagaatggt
cttgtcagggacgagaggaatatgcttaaggttgttacacgaatgcatcgagtggtggtg
atccttaaactgctggtacagcagttttctgttctggagacgatgacagccttggacttc
aatgacttcagagagtacttatctccagcgtctggctttcagagtttgcaattccgacta
ttagaaaacaagataggtgtccttcagagttcaagagtaccttacaacagaagacattat
cgtgataacttcaaaggagaagataatgaactgctccttcagtcggagcaggagaaaaca
cttctgcaactagtggaggcatggctggaaagaacaccaggtttagagccacaaggattt
aacttctggggaaagttggaaacaaatattgttaaaggcctggaagaagaattcacaatg
attcagactaaaaaagagtcagaggaaaaagaggagcaaatagctgaatttcagaaacaa
aaagatgtgttactctccttatttgatgagaaacgccacgagcatctccttagtaaaggt
gaaagacgattgtcgtacagagcactgcagggggccttgatgatatatttttacagggag
gaacctagattccaggtccccttccagttgctgacttctctcatggacatagacacactc
ttgactaaatggagatataaccatgtatgcctggtgcacaggatgctgggcagcaaagct
ggcactggtgggtcctcaggctaccactacctgcgttccactgtaagtgacaggtacaag
gtatttgtagatttatttaatctgtcaacatacctggttccccgacactggataccgaag
atgaacccaggtgttcacaaattcctttacacggctaaatactgtgacagctcttacttc
agcagtgaagaatcagattaa

DBGET integrated database retrieval system