KEGG   Desmodus rotundus (common vampire bat): 112312837
Entry
112312837         CDS       T05907                                 

Gene name
NPAS1
Definition
(RefSeq) neuronal PAS domain-containing protein 1
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112312837 (NPAS1)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112312837 (NPAS1)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 PAS_4 HLH Caskin-Pro-rich
Other DBs
NCBI-GeneID: 112312837
NCBI-ProteinID: XP_024425174
Position
Unknown
AA seq 574 aa
MAAPYPSGGGRGEVRYGAGRGGSVPWDFLPGLMVKAPPGPCLLAQRKEKSRNAARSRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVSLLICKTGTRAPGRRGPVALVSEVFEQHLGGH
ILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYIHPGDHSEVLEQLGLR
TRTPGPPTPPSIPSSSSSSSSSSSSLADTPEIEASPTEVTPSSGVQERSFFIRMKSTLTK
RGLHVKASGYKVIHVTGRLRARALGLVALGHTLPPAPLAELPLHGHTIVFRLSLGLTILA
CESRVSDHMDLAPSELVGRSCYQFIHGQDAARIRQSHLDLLDKGQVMTGYYRWLQRAGGF
VWLQSVATVAVNGKSPGERHVLWVSYVLSHPEGGQTPLDTFQLPAGTAREDASSPQPEPA
EPASPVQEKQAAPPDKDEAPPTRGKGIKVEPGWGETKDTEDSGDEEPAGPPAPPRREFTS
VIRTGALKQDLVRPWGLVSPGDPPPSLLHAGFLPPVMRGLCTPSTIRYGPTELGLMYPHL
QRLGPGPSFPEAFYPPLGLPYPGPTSTRVQRKGD
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggcggccccctatcccagcgggggcggcagaggagaggtcagatacggggcaggtcgt
ggtggcagcgtcccgtgggactttttgcctggactcatggtcaaggccccgcccggaccc
tgcctactggcgcagcgcaaggagaagtcccggaacgcggcgcgctcgcggcgcggaaaa
gagaacctggagttcttcgagctggccaagctgctcccgctgcccggagccatctcgagc
cagctggacaaggcgtccatcgtaagtttactcatctgcaaaacgggcacccgagcccca
ggccgcaggggccccgtggcactggtctccgaagtcttcgagcagcacctgggaggacac
atcttgcagtccctggatggctttgtgtttgccttgaaccaggaggggaagttcctctac
atctcagagacggtttccatttatctgggcctctcacaggtggagctgacgggcagcagc
gtcttcgactacatccatcctggggaccactcagaggtgctggagcaactggggctgagg
acccggacccccgggccccccactccaccctccatcccttcctcttcctcctcctcctcc
tcatcttcctcctcgcttgccgatacccctgagatcgaggccagccccacggaggtgacc
ccctcctctggggtccaggagcgctcctttttcatccgcatgaaatccacgctcaccaag
cggggcctgcacgtcaaggcctcggggtacaaggtcatacacgtgactggtcgccttcgg
gcacgtgcgctgggccttgtggcccttggccacacgttgcccccggccccactggctgag
ctgccgctgcacggacacacgatcgtcttccgcctcagcctgggtctcaccatcctggct
tgtgagagcagagtcagcgaccacatggacctggcgccctcggagctggtgggccgcagc
tgctaccagtttatccatggacaggacgcagccaggatccgccaaagccacctggacctg
ctggacaagggccaggtgatgaccgggtactaccgctggctgcagcgtgccgggggcttc
gtgtggctgcagtccgtggccaccgtggctgtaaacgggaagagccctggggagcgccac
gtgctctgggtcagctacgtgctcagccaccccgagggcggccagacacctctggacacc
ttccagctgccagctggcactgcccgtgaggacgcgtccagcccacagccggaacccgca
gagccagcgtccccggtgcaggagaagcaggctgcccccccagacaaggacgaggccccc
ccaacccggggcaaaggcatcaaagtagagcccggctggggggagacgaaagacacggag
gacagcggggacgaggagccggctggccccccagcccctccgcggcgcgagttcacatct
gtcatccgtacaggcgccctgaagcaggacctcgtgcggccctggggcctggtgtctccc
ggggaccccccaccttccctactccatgcgggcttcctgcctcccgtcatgcggggcctg
tgcacgcccagcaccatccgctacggccccacggagctgggcctcatgtacccgcacctg
cagaggctgggcccaggcccctccttcccggaggccttctacccgcccctgggcctgccc
tacccggggcccacgagcaccagggtgcagaggaagggggactga

DBGET integrated database retrieval system