KEGG   Desmodus rotundus (common vampire bat): 112312920
Entry
112312920         CDS       T05907                                 

Gene name
HIF3A
Definition
(RefSeq) hypoxia-inducible factor 3-alpha
  KO
K09096  hypoxia-inducible factor 3 alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112312920 (HIF3A)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112312920 (HIF3A)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1 PAS PAS_4 PAS_9 PAS_2 HLH
Other DBs
NCBI-GeneID: 112312920
NCBI-ProteinID: XP_024425276
Position
Unknown
AA seq 670 aa
MALGLQRARSSTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLT
ISYLRMHRLCAAGEWNQVGTGGEQLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLS
QLELIGHSIFDFIHPCDQEELQDALTPQQSLSKKKPEAPTGRCFSLRMKSTLTNRGRTLN
LKAATWKVLHCSGHLRVYKPPAQTSPARSPNLEPPLQCLVLICEAIPHPGSLEPPLGRGA
FLSRHSLDMKFTYCDERIAEVAGYSPDDLIGCSAYEYIHALDSDAVGQSIHTLLSKGQAV
TGRYRFLARSGGYLWTQTQATVVSGGRGPQSESIICVHFLISRVEETGVVLSLEQTERHS
RRPIQRATHSQKDTRNPGDSLDASGPRILAFLHPPALSEATLAADPRRFCSPDLRRLLAP
ILDGTSVAATPSAPRVTRRPRSPLPADLPDELLGDVENAHKVLGKVSRKDLEAAETDLDI
AQDVDALDLEMLAPYISMDDDFQLNSSEHLPRAYHRPPGAAPRPRARSFHGLSPPPPEPT
LLPRWGSDPRLSFSSPSRGDPSAPSMVGARKRTLAQRSEDEAEGVELLGVRPPKRCPSRE
PERFLLPPLSLSLLLTGAPAPVSQQTPAATSCNLSSPTGLGPSLLGLYPDEDTTQPKSHF
QPAASLAQAD
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcgctggggctgcagcgcgcaaggtcaagcaccgaactccgcaaggaaaaatcccgg
gatgcggctagaagccgtcgcagccaggagacggaggtgctctatcagctggcgcacaca
ctgcccttcgcgcgcggggtcagcgcgcacctggacaaagcctccatcatgcgcctcacc
atcagctacctgcgaatgcaccgcctctgcgcagcaggggagtggaaccaggtgggaaca
gggggtgaacagctggatgcctgctacctgaaggccctggagggtttcgtcatggtgctc
actgccgagggagacatggcttacctgtcggagaatgtcagcaaacacctgggcctcagt
cagcttgagctcattggacacagtatctttgatttcatccatccctgtgaccaagaggag
cttcaggatgccctgaccccccagcagagcctgtccaaaaagaagccggaggcccccacg
gggcggtgcttctccttgcgaatgaagagcaccctcaccaaccgcgggcgcaccctcaac
ctcaaggcggccacctggaaggtgctacactgctctgggcacctgagggtctacaagccc
cccgcacagacgtccccagccaggagccccaacttagagcctcccctgcaatgcctggtg
ctcatttgtgaagccatcccccacccgggcagcctggagcccccgctgggccggggcgcc
ttcctcagccgccacagcctggacatgaagttcacctactgcgacgagaggatagctgag
gtcgctggctacagccccgacgatctgattggctgttctgcttacgagtacatccacgcg
ctggactcggatgcagtgggccagagcatccacaccctgctgagcaagggacaggcagta
acagggcggtatcgcttcctggcacggagtggtggctacctgtggacccagacccaggcc
acagtggtgtcagggggccggggcccccagtctgagagtatcatctgcgtccacttcctg
atcagccgggtggaagagactggagtggtgctgtccctggagcaaacagagcgacactct
cgcagacccattcagcgggccacccactctcagaaggacacccgtaatcctggggacagc
cttgacgcttctggtccccggatcctggccttcctacacccccctgccctgagcgaagcc
accctggctgctgatccccgccgtttctgtagccctgacctccgtcgcctcctggcacct
atcctagatgggacttcagtagctgccacccccagcgcaccccgagtcactcggcgcccc
cggagccccctcccggctgatctcccagatgagctacttggagacgtggagaacgcacac
aaagtcttgggaaaagtctctcggaaagaccttgaggcggctgagacagatctagatata
gcgcaggatgtcgatgccctggatttggagatgctagccccctacatctccatggatgac
gacttccagctcaactccagcgagcacctgcccagggcctaccacaggcctccaggggct
gccccccggccccgagcacggagcttccacggcctgtcacctccacctcctgagcccacc
ctgctgccccgctgggggagcgacccccggctgagcttctccagcccttccagaggggac
ccctcagccccatccatggttggggcccggaagaggaccctggcccagaggtcagaggat
gaggccgaaggggtggagctgctgggagtgagaccccccaaacggtgccccagccgagaa
cctgaacgcttcctactgcctcctcttagcctgagtctcctcctgacaggagcaccagcc
ccagtgagtcagcagaccccagcagccacctcctgcaatctgtcttcccccacaggcctg
ggcccttcactgctaggtctctacccggacgaggacaccacccaacccaagagccacttc
cagccagcagcaagcttggcccaggccgactga

DBGET integrated database retrieval system