KEGG   Desmodus rotundus (common vampire bat): 112313526
Entry
112313526         CDS       T05907                                 

Gene name
ARNT
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator isoform X1
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04066  HIF-1 signaling pathway
dro04934  Cushing syndrome
dro05200  Pathways in cancer
dro05204  Chemical carcinogenesis
dro05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112313526 (ARNT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112313526 (ARNT)
   05204 Chemical carcinogenesis
    112313526 (ARNT)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112313526 (ARNT)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112313526 (ARNT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112313526 (ARNT)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112313526 (ARNT)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PRAS
Other DBs
NCBI-GeneID: 112313526
NCBI-ProteinID: XP_024425857
Position
Unknown
AA seq 792 aa
MAATTAKPEMTSDVPSLGPAVASGNPGPGIQGGGAINVQRPIKRRPGLDFDDDGEGNSKF
LRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTC
SALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIV
SCESGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENTLTGRILDL
KTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDPVSMNRLSFLRNRCRNGLGSVKDG
EPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQ
PTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLK
GQVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTI
QRPQLGPTANLPLEMGSGQLAPRQQQQQQTELDVVPGRDGLASYNHSQVPVQPVTTTGAE
HSKPLEKSDGLFAQDRDPRFPEIYSSISADQTKGISSSTVPATQQLFSQGNTFPPTPRPA
ENFRNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGAAPTWTPSTRPGFSAQQVATQAT
TKTRSSQFGVGSFQTPSSFSPMSLPGASTASPGAAAYPTLTSRGSNFAPETGQTAGQFQT
RTAEGVGVWPQWQGQQPHHRSSSNEQHVQQPSAQQAGQPEVFQEMLSMLGDQNTSYNNEE
FPDLTMFPSFSE
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggcggcaactactgcaaaacccgaaatgacatcagatgtaccatcactgggtccagcc
gttgcctctggaaaccctgggcctgggattcaaggtggaggagccataaatgtccagaga
cctattaagcggcgaccagggttggattttgatgatgatggagaagggaacagtaaattt
ttgaggtgtgatgatgatcagatgtctaatgataaggagcggtttgccaggtcggatgat
gagcagagctctgcggataaagagagactcgccagagaaaatcatagtgaaattgaacga
cggcggcggaacaagatgacagcctacatcacagaactgtcagacatggtacccacctgt
agtgccctggctcgaaaaccagacaagctaaccatcttacgcatggcagtttctcacatg
aagtctttgcgaggaactggcaacacatccactgatggcacctacaagccgtctttcctc
actgatcaggaactgaaacatttgatcttggaggcagcagatggctttctgtttatcgtc
tcatgtgagtcaggccgggtggtatatgtttctgactcagtgacccctgttttgaaccag
ccacaatctgaatggtttggtagcacactctatgatcaggtgcacccagatgatgtggac
aaacttcgtgagcagctttccacttcggaaaacactctgacagggcgcatccttgatctg
aagactggaacagtgaagaaggaaggtcagcagtcttccatgaggatgtgtatgggctca
aggagatcatttatttgccgtatgaggtgtggcaatagctctgtggacccagtttcgatg
aatagactgagctttctgaggaacaggtgcaggaatggacttggctcagtgaaggatggg
gaacctcacttcgtggtggtccactgcacaggatacatcaaggcgtggcccccagcaggt
gtctccctcccagatgatgacccagaggctggccagggaagcaagttttgcctagtggcc
attggcagactgcaggtaactagttctcccaactgtacagacatgagtaatgtttgtcag
ccaacagagtttatttctcgacacaacattgaaggaattttcacttttgtggatcaccgc
tgtgtggctactgttggctaccaaccacaggaactcttaggaaagaatattgtagaattc
tgtcatcctgaagaccagcagcttctaagagacagcttccaacaggtggtgaaattaaaa
ggccaggtgctgtctgtcatgttccggttccggtccaagaatcgagaatggctctggatg
agaaccagctcctttactttccagaacccttactcagatgaaattgagtatatcatctgt
accaacaccaatgtgaagaattctagccaggaaccacggcctacactgtccaacacgatc
cagaggccacagctaggtcccacagctaatttgcccttggagatgggctcagggcagctg
gcacccaggcagcagcagcagcagcaaacagaattggatgtggtaccaggaagagatgga
ctggccagctacaatcattcccaggttcctgttcagcctgtgacaaccacaggggcagaa
cacagcaagcccctggagaagtcagatggtctctttgcccaggatagagatccaagattt
ccagaaatctattccagtatcagtgcagatcagactaaaggcatctcctccagcactgtc
cctgccacccaacagctattctcccagggcaacacattccctcctaccccccggccggca
gagaatttcagaaatagtggtctggccccccctgtaaccatcgtccagccatcagcctct
gcagggcagatgttggcccagatttcacgccactccaaccccacccagggagcagcccca
acttggacccctagtacgcgcccaggcttctctgcccagcaggtggccacccaggctaca
actaagactcgttcttcccaatttggtgtgggcagctttcagacgccgtcatcctttagc
cccatgtccctccccggtgcttctactgcatcacctggtgctgctgcttatcctactctc
accagtcgtggatccaattttgctcctgagactggacagactgcaggacaattccagaca
cggacagcagagggtgtgggagtctggccacagtggcagggccagcagcctcatcatcgt
tcaagttctaatgaacaacatgttcaacagccatcagcacagcaagctggccagcctgag
gtcttccaggagatgctgtccatgctgggagaccagaacaccagctacaacaatgaagaa
tttcctgatctaactatgtttccctccttttcagaatag

DBGET integrated database retrieval system