KEGG   Desmodus rotundus (common vampire bat): 112313555
Entry
112313555         CDS       T05907                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: leukocyte immunoglobulin-like receptor subfamily A member 6
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04380  Osteoclast differentiation
dro04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112313555
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112313555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dro04090]
    112313555
CD molecules [BR:dro04090]
 Proteins
  112313555
SSDB
Motif
Pfam: Ig_2 ig Ig_3
Other DBs
NCBI-GeneID: 112313555
NCBI-ProteinID: XP_024425898
Position
Unknown
AA seq 617 aa
MSPSLAALLCLGLSVGLRTPVQAGTLRKPTLWAEPGSVIPWGSSVTIWCQGILEAKEYRL
DKEGSSTRWDRQKILESGNKAKFSITYVTERTAGRYQCYYLSPTGWSERSDPLELVVTGS
YSKPSLSALPSPVVIPGGSVTLRCHSDEGFGRFILTEEGKDRLSWTLDSQRDPSGQSQAL
FPVGPVIPRQSGTFRCYGYYRNNPQMWSQPSDPLELLVSDPPKPSIWADPGPIISKGSPV
TIWCEGSLQADGYTLYKDRGSPLLDTKVPQASSNKTGFLIESMSSHYAGLYQCAYSTGGS
LSQLSEPLLLVVTGEHSTPSLSAHPGPMVASGGNVSLVCSSQSTWDTFHLLKEGGAELPQ
HRKSERRSYDGRQQTVFPVGPVISSHGGTYRCYGSSNSTPNVWSQPSDPLHLKITGLYRK
PFLSAQQGTSVPWGANVTLQCGSEVRADTFHLHREGSRDPPQHSILQPQAGLSQAQFPLD
TVNSTHGCRYRCYGGHNLSXEWSAPSDPLDILVAGWLPDRPSLSVHPGPTVTSGEKVTLL
CQSQSPRDTFLLSKEGAADPPLCLRSQSRAQQHQAEFSMGPVTSGHGGSYRCYSANHRSP
NLLSQPSDPLELLVSGE
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgtcccccagcctcgcggccctgctctgcctcgggctgagcgtgggcctgaggacccca
gtgcaggcagggaccctccgaaaaccgaccctctgggctgagccaggctctgtgatcccc
tggggaagctcagtgaccatctggtgtcaggggatcctggaggctaaggaataccgtctg
gataaagaggggagctcaacacgctgggacagacagaagatactggaatccgggaacaag
gccaagttctccatcacatacgtgacagagcgcactgcagggagataccagtgttactat
ctcagccccactggctggtcagagcgcagtgaccccctggagctggtggtgacaggatcc
tacagcaagcccagcctctcagccttgcccagccccgtcgtgatcccaggagggagtgtg
actctcagatgtcactcagacgagggatttggccggttcattctgactgaggaaggaaaa
gacaggctctcctggacgctggactcacagcgagacccaagtgggcagtcccaggccctg
ttccctgtgggccccgtgatccccagacagagcgggacattcagatgttatggttattac
aggaacaaccctcagatgtggtcacagcccagtgaccccctggagctcctggtctcagat
ccccccaaaccctccatctgggctgacccaggccccatcatcagcaaggggagccctgtg
actatctggtgtgaggggtctctgcaggcagatggctacactctgtataaagacaggggt
tctccgctcttggatacgaaggtcccacaggcctccagcaacaagaccgggttcctcatc
gagtccatgagctcacactacgcagggctgtaccagtgtgcatacagcactgggggctcg
ctgtcccagctgagtgagcccctgctcctggtggtgacaggagagcacagcacaccctcc
ctctcagcccacccaggccccatggtggcctcaggaggaaacgtgtccctcgtgtgcagc
tcacagtccacatgggacactttccacctgctgaaggagggaggggctgagctgccccaa
cacaggaaatcagaacggagatcctatgatgggaggcagcagactgtcttccctgtgggc
cctgtgatctcctctcatggggggacctacagatgctatggttcctccaactccaccccc
aatgtgtggtcacagcccagtgaccctctgcacctcaagatcacaggactgtacaggaaa
cccttcctctcagcccagcaggggacctcggtgccctggggagcaaacgtgaccctgcag
tgtggatctgaggtcagggctgataccttccacctgcacagggaggggtcccgggatcct
ccccagcattctatcctgcaaccccaggctgggctatctcaggcccagttccccctggac
actgtgaacagtacccatgggtgccggtacaggtgctacggtggacacaacctctcctga
gaatggtcagcccccagtgaccccctggacatccttgtggcaggatggctccctgacaga
ccctccctgtcagtgcacccgggccccacggtgacttcgggagagaaagtgaccctgctg
tgtcagtcacagagcccgagggacactttccttctgtccaaggagggagcagccgatccc
cccctgtgtctcagatcacagtcccgagctcagcagcaccaggcagaattctccatgggt
cctgtgacctcaggccatggggggtcctacaggtgctacagtgcaaaccacaggagcccc
aacctgttgtcacagcccagtgaccccctggagctcctggtctcaggtgagtag

DBGET integrated database retrieval system