KEGG   Desmodus rotundus (common vampire bat): 112313873
Entry
112313873         CDS       T05907                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-2 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112313873
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112313873
   04145 Phagosome
    112313873
  09143 Cell growth and death
   04218 Cellular senescence
    112313873
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112313873
   04612 Antigen processing and presentation
    112313873
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112313873
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112313873
   05330 Allograft rejection
    112313873
   05332 Graft-versus-host disease
    112313873
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112313873
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112313873
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112313873
   05170 Human immunodeficiency virus 1 infection
    112313873
   05168 Herpes simplex virus 1 infection
    112313873
   05163 Human cytomegalovirus infection
    112313873
   05167 Kaposi sarcoma-associated herpesvirus infection
    112313873
   05169 Epstein-Barr virus infection
    112313873
   05165 Human papillomavirus infection
    112313873
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112313873
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112313873
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112313873
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112313873
SSDB
Motif
Pfam: C1-set Ig_3 MHC_I_C ig Ig_2 C2-set_2 I-set
Other DBs
NCBI-GeneID: 112313873
NCBI-ProteinID: XP_024426261
Position
Unknown
AA seq 190 aa
MSAAGLSHDHAKFPNFLTLPSDPPKTHVTHHPISDHEVTLRCWALGFYPSDITLTWQRDG
EDLTQDMDLVETRPVGDGTFQKWAAMDVPPGEEQRYTCQVQHQALPKPLTLKWDPPPQTT
ITILGITAATLGLLGAVGAGAVLWRRRHSGNDGAKGSDVFLTAPKASEHVCIVISFIAGA
GHEATLPTGT
NT seq 573 nt   +upstreamnt  +downstreamnt
atgagcgctgctggactgtcccatgaccatgcaaagttcccaaattttctcaccctcccc
tcagaccctccaaagacacacgtgacccaccaccccatctctgaccacgaggtcaccctg
aggtgctgggccctgggcttctacccttcggacatcaccctgacctggcagcgtgacggg
gaggacctgacccaggacatggacctggtggagaccaggcctgtaggggacgggaccttc
cagaagtgggcggccatggacgtgccccctggggaggagcagagatacacgtgccaagtg
cagcaccaggcgctgcccaagcccctgaccctgaaatgggacccccctcctcagaccacc
ataaccatcctgggcattactgctgccaccctgggcctccttggagctgtgggcgctgga
gctgtgctgtggaggaggaggcactcaggcaatgacggtgccaagggctctgatgtgttt
ctcacagctcctaaggcatcagaacatgtctgcattgttatcagcttcattgcaggagct
ggtcacgaggccaccctccccacagggacctga

DBGET integrated database retrieval system