KEGG   Desmodus rotundus (common vampire bat): 112315005
Entry
112315005         CDS       T05907                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04061  Viral protein interaction with cytokine and cytokine receptor
dro04068  FoxO signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04660  T cell receptor signaling pathway
dro04672  Intestinal immune network for IgA production
dro05133  Pertussis
dro05135  Yersinia infection
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05143  African trypanosomiasis
dro05144  Malaria
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05150  Staphylococcus aureus infection
dro05152  Tuberculosis
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05321  Inflammatory bowel disease
dro05322  Systemic lupus erythematosus
dro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112315005 (IL10)
   04068 FoxO signaling pathway
    112315005 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112315005 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    112315005 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112315005 (IL10)
   04660 T cell receptor signaling pathway
    112315005 (IL10)
   04672 Intestinal immune network for IgA production
    112315005 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    112315005 (IL10)
   05322 Systemic lupus erythematosus
    112315005 (IL10)
   05320 Autoimmune thyroid disease
    112315005 (IL10)
   05321 Inflammatory bowel disease
    112315005 (IL10)
   05330 Allograft rejection
    112315005 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112315005 (IL10)
   05133 Pertussis
    112315005 (IL10)
   05150 Staphylococcus aureus infection
    112315005 (IL10)
   05152 Tuberculosis
    112315005 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112315005 (IL10)
   05144 Malaria
    112315005 (IL10)
   05145 Toxoplasmosis
    112315005 (IL10)
   05140 Leishmaniasis
    112315005 (IL10)
   05142 Chagas disease
    112315005 (IL10)
   05143 African trypanosomiasis
    112315005 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112315005 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112315005 (IL10)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Interleukins
   112315005 (IL10)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Haparin
  Cytokines
   112315005 (IL10)
SSDB
Motif
Pfam: IL10 IL22 CLZ
Other DBs
NCBI-GeneID: 112315005
NCBI-ProteinID: XP_024427437
Position
Unknown
AA seq 178 aa
MPSSALLCCLVFLAGVGASQDQSRLSEKNCSDFPANLPNMLRELRAAFSRVKIFFQVKDQ
LDSMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAESQGPDIKEHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKMKK
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccagctcagcacttctctgttgcctggtcttcctggccggggtgggggccagccaa
gaccagagcaggctatctgagaaaaactgcagtgacttcccagccaacctgcccaacatg
cttcgagagctccgagctgccttcagcagggtgaagattttctttcaagtgaaggaccag
ctggacagcatgctgttgaatgggtccttgctggaagactttaagggttacctgggttgc
caagccttgtcagagatgatccagttttacctagaagaggtgatgccccaggctgagagc
cagggcccagacatcaaggagcacgtgaactccctcggggaaaagctgaagacgctgagg
ctgaggctgcggcgctgtcatcgctttctgccctgtgaaaacaagagcaaagcggtggag
caggtgaagagtgccttcagtaagctccaagagaaaggggtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaatgaagatgaaaaaatga

DBGET integrated database retrieval system