KEGG   Desmodus rotundus (common vampire bat): 112315181
Entry
112315181         CDS       T05907                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dro03021]
    112315181 (AFF3)
Transcription machinery [BR:dro03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     112315181 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 112315181
NCBI-ProteinID: XP_024427603
Position
Unknown
AA seq 1244 aa
MQGEDILNQRNDSLVVEFQSSASRCRSVYEPDRNVLRRKERERRNQETQQDDGTFNSSYS
LFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQAPVNKIDEH
FVADSRAQPQPSSVCSTASSTPAAVPVQQSKRGTMGWQKAGHPPPDGQQRATQQGSLRTL
LGDGVGRQQPRAKQVCNLEVGLQTQERPPNMPAKHSSSGHCVQNFPPSLASKPSLVQQKP
TAYVRPMDGQDQAPDESPKLKSSTETSMHCTSYRGVPATKPESTRAKAKLSKFNIPKQAE
ESRSGETNICVEEIIREMTWLPPLSAIQAPGKVEASKFSFPNKDSQLISSGHNNPKKGDA
EPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTTLHALSDSAAVQQAGCRASVPSSK
GSSSGSSSSGSSSSSDSESSSGSDSETESSSSESEGSKPAHCSSPEAEPASSNKWQLDKW
LNKVNPHKPPVLIQNESHGLESNQYYTPGKDQVQDCGKLTEGCQTSLREKDIKNTCKEEQ
RPRTANKAPGTKGVKQKSPPAAVAVAVTAAAPPPTVPGVSPESVPAPTRRSASKKPPRRT
ERTSAGDSTNCQRQEEPTEALGASAVIPPETTKARPCGNSRTSHRKELRASVTCEKRRTR
GLSRIVPKSKEFIETESSSSSSSSDSDLESEQDEYPLAKAQAVAAASASATASAAVAASV
SDQRLKEAASSISSGTGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSD
EVRSLWVKIDLTLLSRIPEHLPQEPGVLSTPAAKDAESAPPSHPSDTPSEKALPKSKRKR
KCDNEDDYREIKKAQGDKESSARLTASASNTLSANHCNMNINSLAIPINKNEKLLRSPIS
PLSDASKHKHSSEDLTSSSRSNGSGLFASTTSSKKLKADNQLQSHAGDLAKAAHHNSESV
LHKSRPQTEPWSPGSSGHRDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKAL
NYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAA
LCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMSP
NPSPTSSVGSQGSLSSTNALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLA
KENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLS
NT seq 3735 nt   +upstreamnt  +downstreamnt
atgcagggagaagacatcttaaaccagaggaatgactctctagttgtggaatttcagtca
tcagccagccgatgcaggagtgtctatgaaccagatagaaatgtgttacggaggaaagaa
cgagagaggagaaatcaggaaactcaacaggatgatggcacatttaattccagttattcc
ctcttcagcgaaccctacaagactaacaagggggatgagctctccaaccggatccagaat
accttaggcaattatgatgaaatgaaagactttttaactgatagatctaatcagagtcat
ctcgttggtgttcccaaacctggggttcctcaggctcctgtgaacaagattgatgaacat
tttgttgcagattcaagagcccagccccagccctcatctgtttgcagcactgcatcttcc
acaccagcagctgtccctgtgcagcagagtaagaggggcaccatgggctggcagaaggct
gggcacccgccacctgatggccagcagagagcaacacaacagggctctctcaggaccttg
cttggagatggtgttggcaggcagcagccacgggccaaacaagtgtgcaatctagaggtg
ggtcttcagacccaggaaagaccacctaatatgccagccaagcacagcagcagtggacac
tgtgttcagaactttcctccatccctggcttcaaaacccagcctggttcagcagaaaccg
actgcatatgtgcggccaatggacggccaagatcaggctcctgatgagtctccaaagctt
aagtcttccacagaaaccagcatgcactgcacgtcatataggggagtcccggccaccaag
ccagagtccaccagagccaaggccaagctttccaagttcaatatccccaaacaagcagag
gagagtagatctggagaaaccaacatctgtgtggaagaaataatccgggagatgacctgg
cttccaccactttctgctattcaggcacctggcaaagtggaagcaagcaaattttcattt
ccaaataaggactctcagctcatttcctccggacacaataatccaaagaaaggtgatgct
gagccagagagtccagacaatggcacctcgaatacgtcaatgctagaagatgaccttaag
ctaagtagtgatgaagaggagaacgaacagcaggcagcccagagaaccactctccacgct
ctgtctgacagtgccgcggtccagcaggccggctgcagagcctcggtgccttccagcaag
ggcagcagcagcggcagcagcagcagcggcagcagttcgtccagtgactcagagagcagc
tccggatccgactctgagaccgagagcagttccagtgagagtgaaggcagcaagccggcc
cactgctccagccctgaggctgagcctgcttcctctaacaagtggcagctggataaatgg
ctgaacaaagttaatccccacaagcctcctgttttgatccaaaatgaaagccacggcctg
gagagcaatcagtactacaccccggggaaagaccaagtgcaggactgcgggaaactcact
gagggttgccaaaccagcctgagagagaaggacatcaagaacacctgcaaggaagagcag
aggccaaggacagccaacaaggccccagggactaagggggtgaagcagaagtccccaccc
gcggccgtggccgtggctgtgactgcagccgccccaccacccacggtccctggtgtatcc
cccgagagtgtgcccgcacccacgcggaggtctgccagcaagaagccccccaggcgcaca
gagaggacctcagccggcgatagtactaactgccaacggcaggaggagcccacagaggca
ctgggggcgagtgcagtgatccctccagagaccaccaaagccaggccctgtggcaacagc
aggacaagccaccgcaaggagctgcgtgcctcagtcacctgcgagaagcgccgcacgcgg
ggcctaagcaggatagtccccaagtccaaggagttcatcgagaccgagtcatcatcttcg
tcctcctcctcagactccgacctggagtcggagcaggacgagtatcctctggccaaagca
caggctgtggccgctgcctctgcctctgccactgcttctgccgccgtcgctgcctctgtg
agtgaccagaggctcaaggaggccgccagcagcatcagcagtggtactggcccccgcgca
cctgtaggctccatcaacgccaggaccaccagtgacatcgccaaggagctggaggagcag
ttctacacgctggtcccctttggccgcaatgaacttctctcccccttgaaggatagtgat
gaggtcaggtctctctgggtcaaaattgacctgaccctcctgtccaggatcccagaacac
ttgccccaggagcctggggtcttaagcactcctgcagctaaggacgctgagagtgcacct
ccaagccacccctccgacacaccctcagaaaaggctttgcccaaatccaagaggaaacgc
aagtgtgacaatgaagatgactacagggagataaagaaggcccagggagataaagagagc
tctgcacgactaactgcctctgccagtaatactttgtctgctaatcattgcaacatgaac
atcaacagcttggcaatacccataaataaaaatgaaaaattgctccggtcgcccatctca
cccctctccgacgcttctaaacacaaacactccagcgaggacttgacgtcttccagcaga
tccaatggcagtggtctgttcgcatccaccacctccagcaaaaagcttaaggctgataac
cagctgcagtctcatgccggagacctcgcaaaagcagctcatcacaattcggaaagtgtt
ctgcacaagtcacggccacagacagagccgtggtctccaggctccagtggccaccgggac
tgcaagaggcagaaacttgtcttcgatgatatgccacgcagtgcagattatttcatgcaa
gaagctaaacggatgaagcataaagcagatgcaatggtggaaaagtttggaaaggcattg
aactatgctgaagcagccttgtcattcattgagtgtggaaatgcaatggaacagggccca
atggaatccaagtctccttacacaatgtattcagaaacagtggagcttataaggtatgct
atgagactgaaaacccactcaggacccaatgccacaccagaagataaacaactggctgca
ttatgttaccgatgcctggctctcctgtactggcggatgtttcgactcaaacgggatcat
gctgtgaagtattcaaaagcacttatcgactattttaagaattcatctaaagctgcccaa
gccccatctccatggggggccagtggaaagagcactggaaccccatctcccatgtctccc
aacccctcccccaccagctctgtgggatctcaggggagcctctccagtaccaacgccctg
tccccgtcaaccatcgtcagcatcccacagcgcatccaccagatggcagccaatcacgtc
agcatcaccaacagcattctccacagctatgactactgggagatggcagacaacctggcc
aaggagaacagagaattcttcaacgacctggatctgctcatggggcctgtcaccctacac
agcagcatggaacacctggtgcagtactcccagcagggcctgcactggctgcggaacagc
gcccacctgtcatag

DBGET integrated database retrieval system