KEGG   Desmodus rotundus (common vampire bat): 112315183
Entry
112315183         CDS       T05907                                 

Gene name
NPAS2
Definition
(RefSeq) LOW QUALITY PROTEIN: neuronal PAS domain-containing protein 2
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    112315183 (NPAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112315183 (NPAS2)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112315183 (NPAS2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9
Other DBs
NCBI-GeneID: 112315183
NCBI-ProteinID: XP_024427607
Position
Unknown
AA seq 822 aa
MDEDEKDKAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLGKVISFLQKHN
EVSAQMKISDIQQDWKPSFLTNEEFTQLMLEALDGFIITVTTDGSILYVSDSITPLLGHL
PSDVMDQNLLNFIPEQEHSEVYKMLSSHVLVTDSPSPGYLKSDNDLEFYCHLLRGCLNPK
GFPTYEYIKFVGNFHSYNNVPSLSCRGFNSALVRPCQVPLGKKVCFIATVRLATPQFLKE
ICVVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLTRCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYSDVQVER
RQELALEDPPSEAIHPSALKGSSLEPQQHFKALDIDTSGLNTSHSPSASSRSSHKSSHTT
MSESISIPSKLITEASTTAVPRLVVQPREFPVQGLSQAATIPVCPLFSSSSCDLTQQLLP
QTIFQNSPAALAQFPAPFSMFQTIKDQLEQRTRALQTNIQWQQEELHRIQEQLCLVQHSS
IQMFLQQPAVSLSFSSAQRCDAQQQLPQRSAPGAQSPLTTNLQLPGQMTSTQVTDQHLLR
ESSVTSTQVQGPKSTRRMQMISAGRHPVGSLTTSFSSPTAVLSPTLSLTTLASNTQDTNQ
CQPNPDFSHDRQLRLLLSQPIQPIMPGSCDARQTSEVGRTGQHIKYPQSQAVFPNADVHS
SSSSASTPILMMGQAVLHPSFPSSQPAPLQPTQAQQQPQQHFPQIQVPTSLHSEQQDSLQ
PLLSTYLQQPGTLGFAPQPQPPRPPRRVSSLSESSVLQQLPQ
NT seq 2469 nt   +upstreamnt  +downstreamnt
atggatgaagatgagaaagacaaggcaaagagagcttctcggaacaagtctgagaagaag
cgtcgagaccagttcaatgttctcatcaaagagcttagctccatgctccctggaaacaca
cggaaaatggacaaaaccaccgtgctgggaaaggtcatcagttttctgcagaaacacaat
gaagtctcagcacaaatgaaaatctctgatattcagcaggactggaaaccttccttcctc
actaatgaagaattcacccagctgatgttagaggcattagatggctttatcatcactgtg
acaacagatggcagcatcctctatgtttctgacagtatcacacctctcctcgggcacttg
ccgtcagatgtcatggatcagaatttattaaatttcattccagaacaagaacattcagaa
gtttataagatgctctcttcccatgtgcttgtgacagattccccctccccaggatactta
aaatctgacaatgatttagagttttattgccatcttctcagaggctgcttgaatccaaag
ggatttccaacttatgaatacataaaatttgtaggaaattttcactcctacaacaatgtg
cctagcctctcctgtcgtggctttaacagcgcccttgtaaggccttgccaggtacctcta
ggaaagaaggtctgcttcatcgctactgttcgcctagcaacaccacaattcttaaaggaa
atctgtgtagttgacgaacctctagaggaattcacttcaaggcacagcttggaatggaag
tttttatttctggatcacagagcccctccaataataggataccttccttttgaagttttg
ggaacctcaggttatgactactaccacattgatgatctggagctcctcactaggtgtcac
cagcacctgatgcagtttggtaaagggaagtcatgttgctaccggtttctaaccaaaggc
cagcaatggatttggctgcagacccactactacatcacctaccatcagtggaactccaag
cctgagttcatcgtctgcacacattcagtggtcagttactcggatgtccaggtagaaagg
aggcaggagctggctttggaagacccaccatctgaggccatccacccttcagcactaaag
ggctcaagcctggagcctcagcagcactttaaggcacttgacatagacacttcaggcctt
aacacaagtcactcgccatcagcgtcctcaagaagttcccataaatcctcgcacacaacc
atgtcagaatccatctccattccaagcaagctgataacggaggccagcaccacggctgtg
ccaagattggttgtccagccccgagagttccctgtgcaagggctcagccaggcagccacc
ataccggtatgtcctctcttttcctcatcgtcctgtgacctcacacagcagctcctgcct
cagaccatctttcagaactcacctgctgccctggcacagtttccagcaccgttcagcatg
ttccagaccatcaaagatcagctagagcagcgcacacgggccctgcaaaccaacatccag
tggcagcaggaggagctccacaggatccaggagcagctgtgcctggtccagcactccagc
atccagatgtttctgcagcaaccagctgtatccctgagctttagcagtgcccagcggtgt
gatgctcaacagcagctccctcagaggtcagccccaggggcccagtccccactcaccaca
aaccttcagcttccagggcagatgacctccacccaggtcacagaccagcacctgctcaga
gaatcaagtgtgacatcaacccaggttcagggtcccaagtcaaccagaagaatgcagatg
atatcagcaggtcgccaccctgtgggcagcctgacaacctcgttcagcagccctacagct
gtgctctcaccaactctgagcctgaccacactggcctctaacacccaggacaccaaccag
tgccagcccaacccggacttcagccatgataggcagctcaggctattgctgagccagcca
atccagcccataatgcctgggtcctgtgatgcaaggcagacctctgaggttggtaggact
ggacagcacatcaagtatccacagagccaggctgtttttccaaatgcagacgtgcacagc
tccagcagcagcgcctctacccccatcctgatgatgggacaggcagtgctgcatcccagc
ttccccagctcccagccagcacccctgcagcccacacaggcccagcagcagcctcagcag
cacttcccgcagatacaggtgccaacctctttgcacagtgagcaacaggactcactgcag
ccacttctctccacctacttgcagcagccagggaccctgggctttgccccgcagccccag
ccccctcgacctccccgaagggtcagcagtctgtctgagtcctcagtcctccagcagctt
ccccagtag

DBGET integrated database retrieval system