KEGG   Desmodus rotundus (common vampire bat): 112315403
Entry
112315403         CDS       T05907                                 

Gene name
LYN
Definition
(RefSeq) tyrosine-protein kinase Lyn isoform X1
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04062  Chemokine signaling pathway
dro04064  NF-kappa B signaling pathway
dro04611  Platelet activation
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04730  Long-term depression
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112315403 (LYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112315403 (LYN)
   04662 B cell receptor signaling pathway
    112315403 (LYN)
   04664 Fc epsilon RI signaling pathway
    112315403 (LYN)
   04666 Fc gamma R-mediated phagocytosis
    112315403 (LYN)
   04062 Chemokine signaling pathway
    112315403 (LYN)
  09156 Nervous system
   04730 Long-term depression
    112315403 (LYN)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112315403 (LYN)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    112315403 (LYN)
   05169 Epstein-Barr virus infection
    112315403 (LYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112315403 (LYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112315403 (LYN)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112315403 (LYN)
Protein kinases [BR:dro01001]
 Non-receptor tyrosine kinases
  SRC family
   112315403 (LYN)
Membrane trafficking [BR:dro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112315403 (LYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 DUF2070
Other DBs
NCBI-GeneID: 112315403
NCBI-ProteinID: XP_024427857
Position
Unknown
AA seq 522 aa
MSLLCIPTGNMGCIKSKRKDNLNDDGIDLKTQPVRNTDRTIYVRDPTSNKQQRPVTESQL
LPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFRKGEKMKVLEEHGEWWKAKSLSTKRE
GFIPSNYVAKVNTLETEEWFFKDITRKDAERQLLAPGNSPGAFLIRESETLKGSYSLSVR
DYDPMHGDIIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQPDGLCRRLEKACISPK
PQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYHNTTKVAVKTLKPGTMSVQAFLEE
ANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQ
IAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARIIEDNEYTAREGAKFPIKWT
APEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPE
ELYEIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtcattgctttgtattccaacaggaaatatgggatgtataaaatcaaaaaggaaagac
aatctgaatgacgatggaatagatttgaagacgcaaccagtacgtaatactgaccgaact
atttatgtgagagatccaacgtccaataaacagcaaaggccagttacagaatctcagctt
ttaccaggacagaggtttcagactaaagatccagaggagcaaggagacattgtggtagcc
ttgtacccctatgatggcatccacccagacgacttgtctttcaggaaaggagagaagatg
aaagtcttggaggagcatggagaatggtggaaagccaaatccctttcaacaaagagagaa
ggcttcatccccagcaactacgtagccaaagtcaacaccttggaaacagaagagtggttt
ttcaaggatataaccaggaaagatgcagaaaggcagcttctggcaccagggaacagccct
ggggctttccttatcagagaaagtgaaacattaaaaggaagctactctctttctgtcaga
gattatgaccctatgcacggtgatattattaagcactacaaaattagaagtctggacaat
gggggttattacatctctccaagaatcacttttccttgtattagtgacatgattaagcat
taccaaaagcagccagatggcttgtgcagaagattggagaaggcttgtattagtcccaaa
ccgcaaaagccgtgggataaagatgcctgggagatcccacgagagtccattaagttggtg
aagaggctcggtgctgggcagttcggggaagtctggatgggttactatcacaacaccacc
aaagtggctgtaaaaaccctgaaaccaggcaccatgtctgtgcaggccttcctggaggag
gcaaacctcatgaaaacccttcagcacgacaagctggtgaggctgtacgccgtggtcacc
agagaggagcccatctacatcatcacggagtacatggccaaaggcagtttgctggatttc
ctgaagagtgatgaagggggcaaagtgctgcttccaaagctaattgacttttctgctcag
atcgcagagggaatggcgtacatcgagaggaagaactacattcaccgagacctgcgagca
gctaacgtcctggtctctgagtctctcatgtgcaaaatcgccgattttggccttgctcga
ataattgaagataacgagtacacagcaagggaaggtgctaaattccccatcaagtggaca
gctccggaagcaatcaacttcggatgtttcaccatcaagtctgatgtgtggtcctttgga
attctcctgtatgaaattgtcacctatgggaaaattccctacccagggagaactaatgcc
gatgtgatgaccgcactgtctcagggctacaggatgcctcgcatggagaactgcccggag
gagctctatgaaatcatgaagatgtgctggaaagaaaaggcagaagagaggccaacgttt
gattacctgcagagcgtcctggatgatttctacactgccacagaaggccagtatcagcag
cagccttag

DBGET integrated database retrieval system