KEGG   Desmodus rotundus (common vampire bat): 112317040Help
Entry
112317040         CDS       T05907                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00071  Fatty acid degradation
dro01212  Fatty acid metabolism
dro03320  PPAR signaling pathway
dro04152  AMPK signaling pathway
dro04714  Thermogenesis
dro04920  Adipocytokine signaling pathway
dro04922  Glucagon signaling pathway
dro04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112317040 (CPT1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    112317040 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    112317040 (CPT1A)
   04920 Adipocytokine signaling pathway
    112317040 (CPT1A)
   03320 PPAR signaling pathway
    112317040 (CPT1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    112317040 (CPT1A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112317040 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dro03029]
    112317040 (CPT1A)
Enzymes [BR:dro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     112317040 (CPT1A)
Mitochondrial biogenesis [BR:dro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    112317040 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 112317040
NCBI-ProteinID: XP_024429769
Position
Unknown
AA seq 799 aa AA seqDB search
MRVFLTSSKTVPHGPPSASLPSRSLKMAEAHQAVAFQFTVTPDGIDLRLSHEALKQIYLS
GLHSWKKKFIRLKNGIITGVYPASPSSWLIVVVGVMSTMYAKMDPSLGIIAKINRTLDTT
GCMSSQTKHVVSGVLFGTGLWVALIFTMRYSLKVLLSYHGWMFAEYGKMSRATKIWMGMV
KIFSGRKPMLYSFQTSLPRLPVPTVKDTVTRYLESVRPLMKEADFKRMTALAEDFAVSLG
PKLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYVTPTHIQAARAGN
AIHAILLYRRKLDREELKPILLLGSTVPLCSAQWERMFNTSRVPGEEADTIQHVRDSKHI
VVLHKGRYFKVWLYHDGRLLRPREIEQQMQRILDDPSEPQAGEAKLAALTAGERVPWARC
RQAYFARGKNKQSLDAVEKAAFFVTLDDSEQGYRKEDAETSMDTYAKSLLHGRCSDRWFD
KSFTFIVFKNGKMGLNAEHSWADAPIVGHLWEYVMSTDSFQLGYLEDGHCKGDTNPNIPY
PTRLQWDIPEECQEVIEASLASASLLANDVDFHSFPFDAFGKGLIKKCRTSPDAFVQLAL
QLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTSESCSFVLAMADPSRTVEQRLQLFK
AACERHQHLYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQV
ELFDLERNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETDSHRLGRHL
KQAMTDIITLFGFGSNSRK
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtttttctaacatccagtaagacggtcccccacggtccgccctctgcctctctt
cccagcagatcgctaaagatggcagaagcccaccaagctgtggccttccagttcacggtc
actccggacgggatcgacctgcggctgagccatgaagccctgaagcaaatctatctgtct
ggacttcactcctggaaaaagaagttcattagactgaagaatggcatcatcaccggcgtg
tacccggcgagcccctccagctggctcatcgtggtggtgggcgtgatgtcaaccatgtac
gccaagatggacccctcgctggggatcatcgctaagatcaaccggacccttgacaccacg
ggctgcatgtccagccagacgaagcacgtggtcagcggcgtgctgttcggcacgggcctg
tgggtggccctgatcttcaccatgcgctactccctgaaggtgctgctgtcctatcacggc
tggatgttcgccgagtacggcaagatgagccgtgccaccaagatctggatgggtatggtc
aagatcttttctggccgcaaacccatgctgtacagcttccagacgtctctgccgcgcctg
cctgtccccaccgtgaaagacacagtgaccaggtatctggagtcggtgaggcctcttatg
aaggaagccgacttcaagcggatgacggctcttgccgaagactttgctgtcagcctcggg
cccaagttacagtggtacctgaagttaaagtcctggtgggcgaccaattacgtgagcgac
tggtgggaggagtacatctacctccggggccgggggccgctgatggtgaacagcaactac
tacgccatggacctgctgtacgtgacgcccacgcacatccaggccgccagggcgggcaac
gccatccacgccatcctgctgtacaggcgcaagctggaccgggaggagctcaagccgatt
ctccttttgggatccacagtcccgctctgctctgcgcagtgggagcggatgttcaacacg
tccagggtcccgggagaggaagcggacaccattcagcacgtgagggacagcaagcacatc
gtcgtgctccacaagggacgctacttcaaggtctggctctaccacgacggcaggctgctg
aggccccgggagatcgagcagcagatgcagaggattttggacgacccgtcggagccgcag
gccggggaggcgaagctggcagccctcactgcgggagaaagagtgccctgggcccgctgc
cgccaggcctactttgcacgcgggaagaacaagcagtctctggacgccgtggagaaggcg
gcgttcttcgtgacgctggacgactcggagcagggctacaggaaggaggacgccgagacc
tcgatggacacctacgccaagtcgctgctgcacggcaggtgttccgacaggtggtttgac
aagtcgttcacgtttattgtcttcaaaaacgggaagatgggcctgaacgctgagcactcc
tgggccgacgcccccatcgtggggcatctctgggagtacgtcatgtccacggacagcttt
cagctgggctatttggaggatggacactgcaaaggggacaccaacccgaacatcccgtac
cccacccggctgcagtgggacatcccggaggaatgccaggaggtgatagaggcgtccctg
gccagcgccagccttctggccaacgacgtggatttccactcttttcccttcgacgctttc
ggaaaagggctgatcaagaaatgccgcacgagcccggacgcctttgtgcagctggccctg
cagctggcgcactacaaggacatgggcaaattctgcctcacctacgaggcctccatgacc
cggctcttccgcgaggggaggacggagaccgtgcggtcctgcacctcggagtcctgcagc
ttcgtgctcgccatggcggacccctcccggacggttgagcagagactccagttgttcaag
gccgcgtgtgagaggcaccagcacctgtaccgcctggcgatgaccggctccgggatcgac
cgccacctcttctgcctctatgtggtgtccaagtatctcgccgtcgagtcccccttcctg
aaggaagtcttgtccgagccttggaggctgtccaccagccagacccctcagcagcaggtg
gagctgtttgatttggagaggaatcccgagtacgtgtccagcggagggggctttgggccg
gtcgccgacgacggctatggcgtgtcgtacatcttggtgggagaaaacctcatcaacttc
cacatatcctccaagttctcctgcccggagacggactcccatcgcctgggaaggcacctg
aaacaggctatgactgacatcatcactctgttcgggttcggctccaactccaggaagtaa

DBGET integrated database retrieval system