KEGG   Desmodus rotundus (common vampire bat): 112317043
Entry
112317043         CDS       T05907                                 

Gene name
ACY3
Definition
(RefSeq) LOW QUALITY PROTEIN: N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112317043 (ACY3)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     112317043 (ACY3)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 112317043
NCBI-ProteinID: XP_024429773
Position
Unknown
AA seq 327 aa
MCSLPVPQEPLRHVAVVAGTHGNEMPGVYLAWYWLQALGELQRPSFSAMPVLASPAAAAA
CRCYVGRDLNCTFTSTFLTXASLPHLDDLYKVTRARELNQLLGPKASGRAFDFILNLHNP
SAADVGTCLIVEAAHIIFALHGPDPALCSHLQNPELVCQVFLYSLLLPGEESFSIHSVAK
NGMGLELGPQPQGMPWADLFTRTRALVATALDFIQLFNQGAAFPAFEMEAYRNVSSKDFP
RTEAGDLAGTVHPQLQGCDGDFEPLWPSAPIFQLVSGEDKLHEGESTVCPVFINEAAHXE
KGIAFLQTEKLPLSVPAPPVLALAPAP
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtgctcactgcctgtgcctcaggagcccctgcgccacgtggctgtggttgcgggcacc
cacggcaatgagatgccgggcgtctacctggcctggtactggctgcaggccctgggggag
ctgcagagacccagcttctctgccatgccagtgctggccagcccagcagccgcagcagcc
tgccgctgctacgtgggccgtgacctcaactgcaccttcaccagcaccttcctcacgtga
gcatccttgccccacctggatgacctgtacaaggtgacaagggcccgagagctgaatcag
ttgctggggcccaaggcctcaggccgggcctttgatttcatcctcaacctgcacaacccc
tcggccgccgacgtgggcacctgcctcatcgtggaagccgcccacatcatctttgccctg
cacggccctgacccagccctctgctcgcacctgcagaacccggagctggtctgccaggtc
ttcctgtactctcttcttctgcctggcgaagagagtttcagcatccactcagtggccaag
aacggaatgggcctggagcttggcccccaacctcagggaatgccatgggctgaccttttc
accaggacgagggctctggtggccacagctctggacttcatccagctcttcaaccagggc
gcagccttccctgcctttgagatggaggcatacagaaacgtgagcagcaaggacttccca
cgcaccgaggccggggacctagctggcactgtgcatcctcagctgcaggggtgtgacggg
gactttgagccgctgtggcccagtgcacccatcttccagttggtcagcggcgaggacaag
ctccatgagggggagtccaccgtgtgccccgtgttcatcaacgaggccgcccactaggag
aagggcatcgccttcctgcagacagagaagctcccgctctccgtgcccgccccgcctgtg
ctggccctcgccccagctccctaa

DBGET integrated database retrieval system