KEGG   Desmodus rotundus (common vampire bat): 112317164
Entry
112317164         CDS       T05907                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00100  Steroid biosynthesis
dro01100  Metabolic pathways
Module
dro_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    112317164 (TM7SF2)
Enzymes [BR:dro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     112317164 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 112317164
NCBI-ProteinID: XP_024429969
Position
Unknown
AA seq 396 aa
MLLLPATMFHLLLAVRSGPARLLDLPQYLPRPEALWSPRALLLWLTWLGLQAAFYLLPAS
KMAEGQELKDKSRLRYPINGFQALVLTALLVGLGVLAGLPLGALTEMLLPLAFVATLTAF
IFSLLLYLKALAAPASALAPGGSSGNPIYDFFLGRELNPRIWSFDFKYFCELRPGLIGWV
LINLALLVQEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTMDIKHDGFGFMLAFG
DLAWVPFTYSLQAQFLLYHPQPLELPMASVICLMNAVGFYVFRAANSQKNTFRKNPSDPR
VADLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYFYLLYFTAL
LVHREARDEQQCLQKYGLAWHEYCKRVPYRIVPYIY
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgctgctgctccctgccaccatgttccacctgctcttggcggttcgctccgggccagcg
cgcctcctggacctaccccagtacctaccgcgacccgaggctctgtggagtccccgggca
ctgctgctgtggctcacctggcttggcctgcaggcggcattctatctactgcctgcgagc
aagatggctgagggccaggaattgaaggacaagagtcgcctgcgctaccccattaacggc
ttccaggccctggtgctgacagccctgttggtgggcctcggggtgttggcggggctgccc
ctgggggcactcacagaaatgctgctgcccttggcgtttgtggccaccctcaccgccttt
atcttcagcctccttctctatctgaaggctctagcagcccctgcctccgccctggcacct
ggggggagctcaggcaatcccatttacgactttttcctgggacgagaactcaacccacgc
atctggtcctttgacttcaaatatttttgcgaactgcggcctggcctcatcggctgggtc
ctcatcaacctggcactgctggtacaggaagcagaacttcgggggagtccctcgctggct
atgtggctggtcaatggcttccagttactctatgtgggtgatgccctctggcatgaggaa
gctgtcctcaccaccatggacatcaaacacgacgggtttggcttcatgctggcctttggg
gacctagcctgggtacccttcacctacagcctgcaggcccagttcctgctgtaccaccca
cagcccctggagttacccatggcctcagtcatctgcctcatgaatgctgttggcttctac
gtcttccgtgcagccaattcccagaaaaacaccttccgaaagaatccttctgaccccaga
gtggcagaccttgagaccatccctacagccacggggaggcagctgctcgtgtctgggtgg
tggggtatggtccgccatcccaactaccttggagatctcattatggctctggcctggtcc
ttgccctgtggggtgtcccacctgctgccctacttctacctcctctacttcactgcgctg
ctggtgcaccgtgaggcccgggacgagcagcagtgtctgcagaagtacggcctggcctgg
cacgagtactgcaagcgtgtgccttaccgaattgtgccctacatctactga

DBGET integrated database retrieval system