KEGG   Desmodus rotundus (common vampire bat): 112317296
Entry
112317296         CDS       T05907                                 

Gene name
CD81
Definition
(RefSeq) CD81 antigen
  KO
K06508  CD81 antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04662  B cell receptor signaling pathway
dro05144  Malaria
dro05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112317296 (CD81)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    112317296 (CD81)
  09174 Infectious disease: parasitic
   05144 Malaria
    112317296 (CD81)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112317296 (CD81)
   04090 CD molecules [BR:dro04090]
    112317296 (CD81)
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112317296 (CD81)
CD molecules [BR:dro04090]
 Proteins
  112317296 (CD81)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 112317296
NCBI-ProteinID: XP_024430157
Position
Unknown
AA seq 235 aa
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGNKPAPNTFYV
GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA
KDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLSCCGSNALTTLTTSLFKNNLCPSGSY
FLSNFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
NT seq 708 nt   +upstreamnt  +downstreamnt
atgggggtcgagggctgcaccaagtgcatcaagtacctgctcttcgtcttcaatttcgtc
ttctggctggccggaggcgtgatcctgggcgtggccctgtggctccgccatgacccccag
accaccaacctcctctacctggagctcggaaacaagcctgcacccaacaccttctacgta
ggcatctacatcctcatcgctgtgggcgctgtgatgatgttcgtcgggttcctgggctgc
tacggggccattcaggagtcgcagtgcctgctggggacgttcttcacctgcctggtgatc
ctctttgcctgcgaagtggccgccggcatctggggctttgtcaacaaggaccagatcgcc
aaggacgtgaagcagttctacgaccaggccctgcagcaggctgtgatggatgacgatgcc
aacaacgccaaggccgtggtgaagaccttccatgagacgctcagctgctgtggctccaac
gcactgacgacgctgaccacctcattgttcaagaacaacctgtgtccctctggcagctac
ttcttgagcaactttaaggaggactgccaccagaagatcgatgacctcttctccgggaag
ctgtacctcattggcatcgcggccatcgtggtcgccgtgatcatgatcttcgagatgatc
ctgagcatggtgctctgctgtggcatccggaacagctccgtgtactga

DBGET integrated database retrieval system