KEGG   Desmodus rotundus (common vampire bat): 112317655
Entry
112317655         CDS       T05907                                 

Gene name
DAPP1
Definition
(RefSeq) dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
  KO
K12229  dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112317655 (DAPP1)
SSDB
Motif
Pfam: SH2 PH PH_11
Other DBs
NCBI-GeneID: 112317655
NCBI-ProteinID: XP_024430501
Position
Unknown
AA seq 280 aa
MGRAESLEGKMSTQDPSDLWSRTDGEAELLQDLGWYHSNLTRHAAEALLLSNGCDGSYLL
RDSNERTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFPSLKDFVKHFANQPLIGSETG
TLIVLKHPYPREVEEPSIYESVRVHTAMQTGRTEHDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLDQREGTIRSRSFIFK
NT seq 843 nt   +upstreamnt  +downstreamnt
atgggcagagcagagtctctagaagggaagatgagcacccaggatccttcagatctgtgg
agcagaaccgatggagaagctgagctgctgcaggacttggggtggtatcacagcaacctt
acgcgccacgcagcggaggctctcctcctctcaaacggatgtgatggtagctaccttctg
agggacagcaatgaaaggactgggctgtactctctctccgtcagagcgaaagattctgtc
aaacactttcatgttgaatatactggatattcatttaaatttggcttcaatgaattccca
tctttgaaggattttgtcaagcattttgcaaatcagcctttgattggaagtgagacaggc
actctgattgttctgaaacatccctatccaagagaagtggaagaaccttccatctatgaa
tccgtccgggttcacacagcaatgcagacaggaagaacagaacacgacctggtgcccact
gcaccttctctgggcaccaaagaaggctacctcaccaaacaggggggcctggtcaagacc
tggaaaacgaggtggttcactctgcacaggaatgaactgaaatacttcaaagaccagatg
tcaccagaaccaattcggatcctggacttaacagaatgttcagctgtacaatttgattac
tcacaggaaagggtaaactgtttttgcttagtatttccattcaggacattttatctctgt
gcaaagacgggggtagaagctgatgagtggatcaagatactacgttggaaattgtctcaa
ataagaaaacagctggaccaaagggaaggcacaatccgatcccggtccttcatctttaaa
tag

DBGET integrated database retrieval system