KEGG   Desmodus rotundus (common vampire bat): 112317734Help
Entry
112317734         CDS       T05907                                 

Gene name
ATP1A2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-2
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04260  Cardiac muscle contraction
dro04261  Adrenergic signaling in cardiomyocytes
dro04911  Insulin secretion
dro04918  Thyroid hormone synthesis
dro04919  Thyroid hormone signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04960  Aldosterone-regulated sodium reabsorption
dro04961  Endocrine and other factor-regulated calcium reabsorption
dro04964  Proximal tubule bicarbonate reclamation
dro04970  Salivary secretion
dro04971  Gastric acid secretion
dro04972  Pancreatic secretion
dro04973  Carbohydrate digestion and absorption
dro04974  Protein digestion and absorption
dro04976  Bile secretion
dro04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    112317734 (ATP1A2)
   04022 cGMP-PKG signaling pathway
    112317734 (ATP1A2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112317734 (ATP1A2)
   04918 Thyroid hormone synthesis
    112317734 (ATP1A2)
   04919 Thyroid hormone signaling pathway
    112317734 (ATP1A2)
   04925 Aldosterone synthesis and secretion
    112317734 (ATP1A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112317734 (ATP1A2)
   04261 Adrenergic signaling in cardiomyocytes
    112317734 (ATP1A2)
  09154 Digestive system
   04970 Salivary secretion
    112317734 (ATP1A2)
   04971 Gastric acid secretion
    112317734 (ATP1A2)
   04972 Pancreatic secretion
    112317734 (ATP1A2)
   04976 Bile secretion
    112317734 (ATP1A2)
   04973 Carbohydrate digestion and absorption
    112317734 (ATP1A2)
   04974 Protein digestion and absorption
    112317734 (ATP1A2)
   04978 Mineral absorption
    112317734 (ATP1A2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112317734 (ATP1A2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    112317734 (ATP1A2)
   04964 Proximal tubule bicarbonate reclamation
    112317734 (ATP1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112317734 (ATP1A2)
Enzymes [BR:dro01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     112317734 (ATP1A2)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112317734 (ATP1A2)
  Exosomal proteins of other body fluids (saliva and urine)
   112317734 (ATP1A2)
  Exosomal proteins of colorectal cancer cells
   112317734 (ATP1A2)
  Exosomal proteins of bladder cancer cells
   112317734 (ATP1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Sigma70_r4
Motif
Other DBs
NCBI-GeneID: 112317734
NCBI-ProteinID: XP_024430564
Position
Unknown
AA seq 1020 aa AA seqDB search
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSSILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSTNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtggggctggacgtgaatactcacctgcagccactactgcagagaatggaggc
ggcaagaagaaacagaaagagaaggagctggatgagctgaaaaaggaggtggccatggat
gaccacaagctatccttggatgagctgggccgtaaataccaagtggacctatccaagggc
ctcaccaaccagcgggcccaggacatcctggctcgggatgggcccaatgccctcactcca
cctccgacaacacctgagtgggtcaagttctgtcgccagcttttcgggggcttctccatc
cttttgtggattggggccatcctctgcttcctggcctatggcatacaggctgccatggaa
gatgaaccatccaatgacaatctatatctaggtgtggtgctggcagctgtagtcatcgtc
actggctgcttctcctactaccaagaagccaagagctccaagatcatggattcattcaaa
aatatggttccacagcaagccctcgtggtgcgggagggcgagaagatgcagatcaatgcg
gaggaagtggtggtgggagacctggtggaggtgaagggtggagaccgtgtgcctgctgac
ctccggatcatctcttctcatggctgtaaggtggacaactcatctctaactggcgagtca
gagccccagacccgctcccccgagtttacccatgagaaccccctggagactcgcaatatc
tgtttcttttctaccaactgtgtggaaggcactgccaggggtatcgtgattgccacaggt
gaccggacagtaatgggccgcatagccactctggcctcaggcctggaggttgggcggacc
cctatagccatggagattgaacacttcatccagctgatcacaggggtggctgtgtttctg
ggtgtctccttcttcgtgctgtccctcatcctgggctacagctggctggaggcagtcatc
ttcctcatcggcatcatcgtggccaacgtgcctgagggtctgctggccactgtcactgta
tgtttgaccctgacagccaagcgcatggcaaggaaaaactgtctggtgaagaatctggag
gcagtggagaccctgggctccacctctaccatctgctctgacaagacgggcaccctcacc
cagaatcgcatgaccgttgcccacatgtggtttgacaaccagatccatgaggctgacacc
accgaagaccagtctggggccacttttgacaaacgatctcccacgtggacagccctgtct
cggattgctggtctctgcaaccgtgcagtgttcaaagcagggcaggagaacatctctgtg
tctaagcgtgacacagctggtgatgcctctgagtcagctctgctcaagtgtattgagttg
tcctgtggctccgtgaggaagatgagggacagaaaccccaaggtggcagagattcctttc
aactccaccaacaaataccagctgtccatccatgagcgagaagacagccctcagagccat
gtgctggtgatgaagggggccccagagcgcatcctggaccggtgctcctccatcttggtg
cagggcaaggagatccctctggacaaggagatgcaagatgcctttcagaatgcctacatg
gagctgggaggactgggggagcgagtgctggggttctgtcagctgaatctgccctctgga
aagtttcctcgtggcttcaaatttgacacggatgaacttaactttcccacggagaagctc
tgctttgtggggctcatgtccatgatcgaccccccccgggctgctgtgccagatgctgtg
ggcaagtgtaggagtgcaggcatcaaggtgatcatggtgactggggaccacccaatcaca
gccaaggctattgccaaaggcgtgggcattatatcggagggcaatgaaactgtggaggac
attgcagcacggctcaacatccctgtcagtcaagtcaaccccagagaggccaaggcatgt
gtggtacatggctctgacctgaaggacatgacatcagagcagctggatgagatcctcaag
aaccacacagagattgtttttgcacggacatctccacagcagaagcttatcattgtagag
ggctgtcagaggcagggagccattgtggcagtgacaggtgatggcgtgaatgactctcca
gcactgaagaaggcagatatcggcattgccatgggcatctcaggctccgatgtctctaag
caggcagctgacatgatcctgctggacgacaactttgcctctattgtcacaggcgtggag
gagggccgcctcatctttgacaacctgaagaaatccatcgcgtacaccctgaccagcaac
atccctgagattacccccttcctgctcttcattattgccaacatacccctgccactgggc
actgtgaccatcctctgcattgacctgggcactgacatggtccctgccatctccttggcc
tatgaggcagctgagagtgacatcatgaagcgacagccaagaaactcacagacagacaag
ctggtgaacgagaggctcatcagcatggcctatggacagatcgggatgatccaggctcta
ggaggcttctttacctacttcgtgatcctggcagagaacggtttcctgccatcacggttg
ctgggaatccgcctcgactgggatgaccggtccacgaatgacctggaggacagctatgga
caagagtggacctatgagcagcgaaaggtggtggagtttacctgccacacagcctttttt
gccagcatcgtggtggtgcagtgggctgacctcatcatctgtaagacccgccgcaactca
gtcttccagcagggcatgaagaacaagattttgatttttgggctcctggaagagacagca
ctggctgcctttctttcctactgcccaggcatgggtgtggccctccgcatgtacccgctc
aaggttacctggtggttctgtgccttcccctacagtctcctcatcttcatctatgatgag
gtccgaaagctcatcctgaggcgatatcctggtggctgggtggaaaaggaaacatactac
tga

DBGET integrated database retrieval system