KEGG   Desmodus rotundus (common vampire bat): 112318060
Entry
112318060         CDS       T05907                                 

Gene name
IL5
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-5
  KO
K05428  interleukin 5
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04630  JAK-STAT signaling pathway
dro04640  Hematopoietic cell lineage
dro04657  IL-17 signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04660  T cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04672  Intestinal immune network for IgA production
dro05200  Pathways in cancer
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05321  Inflammatory bowel disease
dro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112318060 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112318060 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112318060 (IL5)
   04660 T cell receptor signaling pathway
    112318060 (IL5)
   04658 Th1 and Th2 cell differentiation
    112318060 (IL5)
   04657 IL-17 signaling pathway
    112318060 (IL5)
   04664 Fc epsilon RI signaling pathway
    112318060 (IL5)
   04672 Intestinal immune network for IgA production
    112318060 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112318060 (IL5)
  09163 Immune disease
   05310 Asthma
    112318060 (IL5)
   05320 Autoimmune thyroid disease
    112318060 (IL5)
   05321 Inflammatory bowel disease
    112318060 (IL5)
   05330 Allograft rejection
    112318060 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112318060 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112318060 (IL5)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Interleukins
   112318060 (IL5)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Haparin
  Cytokines
   112318060 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 112318060
NCBI-ProteinID: XP_024430868
Position
Unknown
AA seq 240 aa
MTLPTAKCKCGATTYQPRGFLLYYKLFLKGEKQGFSLLKDKNEFFXRXKALETLVSXYAI
IRQSLSDGWKLFISSKRENKLVGDTXLNNALSLPTASATHFRATRMLLHLSLLALGAAST
CAAAVLSPMQRLVAETMALLSTHQAVLIGDGSLMIPTPGHKDHQLCIEEVFQGVQTLKNQ
TARGDAVEKLFQNLSSIKEYIDGQRKIKCEGERWRVKKFLEYLQKFLGVMNTEWAMESED
NT seq 723 nt   +upstreamnt  +downstreamnt
atgactctcccaacagcaaaatgcaaatgtggggcaacgacatatcaacccagaggtttt
cttttgtactataaactgtttttgaagggggaaaaacagggattttcattattaaaagat
aaaaatgaatttttttaaagatagaaggcattggaaacattggtttcataatatgccatt
attagacagtctctatctgatggatggaaattattcatttcctcaaagagagagaataaa
ttggttggggatacangtctaaacaatgcactttctttgcccacggcaagcgctacacat
ttcagagccacgagaatgcttctgcatttgagtctcctcgctcttggagctgcctctacg
tgtgccgctgccgtgctgagtcccatgcaaaggctggtggcagagaccatggccttgctc
tccactcaccaggctgtgctgataggcgatgggagtctgatgatccctactcccggacac
aaagatcaccaactgtgcattgaagaagtctttcagggggtacagacgctgaagaatcag
accgcccgaggagacgccgtggaaaaactcttccaaaacctgtcttcaataaaagagtac
atagacggccaaaggaaaattaagtgtgaaggggaacgatggagagtaaaaaaattcctg
gaatacctgcaaaagtttcttggtgtgatgaacaccgagtgggcaatggaaagtgaagac
taa

DBGET integrated database retrieval system