KEGG   Desmodus rotundus (common vampire bat): 112318454
Entry
112318454         CDS       T05907                                 

Gene name
ARNTL2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like protein 2
  KO
K09099  aryl hydrocarbon receptor nuclear translocator-like protein 2
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112318454 (ARNTL2)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112318454 (ARNTL2)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 112318454
NCBI-ProteinID: XP_024431483
Position
Unknown
AA seq 606 aa
MAAGEEDAARGKVLIEDNQFIVPMVTNHRSPWTKPTATGSFSPHVTEFPRKRKGSDSDPS
QEAHSQTEKRRRDRMNNLIEELSAMVPQCKPMARKLDKLTVLRMAVQHFKTLKGVTNSYT
GDTYRPSFIQDNELRHLILKAAEGFLFVVGCERGKILFVSKSVSKILNYDQANLTGQSLF
DFLHPKDVAKVKEQLSSSDISPREKLIDAKTGLQVHSGFHAGRMHACSGSRRSFFCRMRS
CKVSVRGERECLPDATRKDHRKFCTIHCTGYLRDWPPGVVGMEEERDHKKDSNFTCLVAI
GRLYPRIVPQNRGEIKVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYFH
QDDHSNLSDKHKAVLQSKEKIFTDSYKFRVKDGSFVTLKSQWFSFTNPWTKELEYIVSVN
TLVLGHGETGEAAASLSCSAQSSRKSCISVPGMGTGTVLGAGSIGTDIANEVLDLQSNHF
NDIMEGKITFMVGTKKIKRLQPSSFLGGSSPTDSVKDIHTVNCRNVSGKELIPLSPPETG
KLGATQQDHSTVAPHSQEPLLGDGAQLDFDALCDNDDTAIAAFMNYLEAEGGLGDPEDFS
DIRWTL
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggcggcgggagaggaggatgcggcgagaggtaaagtgttgatagaggacaaccagttc
attgttcccatggttaccaatcacaggagcccatggacaaaaccgacagctactggctcc
ttcagcccacacgtgacagagttcccacgaaaacgaaaaggaagtgattcagatccttcc
caagaagctcacagccagactgaaaagcggaggagagacagaatgaataacctgattgaa
gagctgtctgcaatggtcccacagtgcaagcccatggcacgaaaactggacaaactcaca
gttttaaggatggccgttcaacacttcaagactttaaaaggtgttacaaattcttacaca
ggagatacttatcgaccttcatttattcaggataatgaactcagacacttaatccttaag
gctgcagaaggcttcctgtttgtggttggatgtgaaagggggaaaattctcttcgtttct
aagtcagtctccaaaatacttaattatgatcaggctaatttgactggacaaagcttattt
gacttcttacatccaaaagatgttgccaaagtaaaggaacaactgtcttcttctgatatt
tcaccaagagagaagctaatagatgccaaaactggtttgcaagttcacagcggcttccat
gcgggaaggatgcacgcatgctctggctccaggcggtccttcttctgtcggatgaggagc
tgtaaggtctccgtcaggggagagcgtgagtgcttgcctgacgcgacgaggaaagatcac
cgaaaattctgtactatccactgcacgggttacttgagagactggccccccggtgttgtt
ggaatggaagaagaaagggaccataagaaagacagtaatttcacctgccttgttgccatc
gggagattgtatccacgtattgtcccacagaaccgtggggagattaaagtgaaacccact
gaatttataacccgttttgcagtgaatggaaaatttgtctacgtggaccaaagggcaaca
gcaattttaggatatttgcctcaggagcttttgggaacgtcgtgttatgaatattttcat
caagatgaccatagtaacttgagtgacaagcacaaagcagttctacagagtaaagagaaa
atatttacagactcgtacaaattcagagtgaaagatggctcttttgtaaccttaaaaagc
caatggtttagtttcacaaatccttggaccaaagagctggagtatattgtgtctgtcaac
actttagttttgggacatggtgagactggagaagcagcagcatcactttcttgcagcgct
caatcctctagaaagtcttgtatcagtgtgcctggaatgggtactggaacagtacttggt
gccggcagtatcggaacagatattgcaaatgaagttctggacttacaaagtaaccacttc
aacgatataatggaagggaagatcacctttatggtagggacaaaaaagataaaaaggtta
cagccttcttcattccttggtggttccagtccaacagattcagtgaaagatattcacact
gtcaactgcaggaatgtgtcaggtaaggagttgattccactaagtcctcctgaaacaggg
aagctgggagccacacagcaagaccacagcactgttgctccccacagtcaggaaccactc
ctaggtgatggtgcccagctggattttgatgccttgtgtgacaatgatgacacagccata
gctgccttcatgaattacttagaagcagaagggggcctgggggaccccgaggacttcagt
gacatccgctggacactttag

DBGET integrated database retrieval system