KEGG   Desmodus rotundus (common vampire bat): 112319176
Entry
112319176         CDS       T05907                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro03050  Proteasome
dro04060  Cytokine-cytokine receptor interaction
dro04066  HIF-1 signaling pathway
dro04217  Necroptosis
dro04350  TGF-beta signaling pathway
dro04380  Osteoclast differentiation
dro04612  Antigen processing and presentation
dro04630  JAK-STAT signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04657  IL-17 signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04940  Type I diabetes mellitus
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05143  African trypanosomiasis
dro05144  Malaria
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05164  Influenza A
dro05168  Herpes simplex virus 1 infection
dro05200  Pathways in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05321  Inflammatory bowel disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    112319176 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112319176 (IFNG)
   04630 JAK-STAT signaling pathway
    112319176 (IFNG)
   04066 HIF-1 signaling pathway
    112319176 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112319176 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112319176 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112319176 (IFNG)
   04612 Antigen processing and presentation
    112319176 (IFNG)
   04660 T cell receptor signaling pathway
    112319176 (IFNG)
   04658 Th1 and Th2 cell differentiation
    112319176 (IFNG)
   04659 Th17 cell differentiation
    112319176 (IFNG)
   04657 IL-17 signaling pathway
    112319176 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112319176 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112319176 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112319176 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    112319176 (IFNG)
   05323 Rheumatoid arthritis
    112319176 (IFNG)
   05321 Inflammatory bowel disease
    112319176 (IFNG)
   05330 Allograft rejection
    112319176 (IFNG)
   05332 Graft-versus-host disease
    112319176 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112319176 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112319176 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112319176 (IFNG)
  09172 Infectious disease: viral
   05164 Influenza A
    112319176 (IFNG)
   05160 Hepatitis C
    112319176 (IFNG)
   05168 Herpes simplex virus 1 infection
    112319176 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112319176 (IFNG)
   05144 Malaria
    112319176 (IFNG)
   05145 Toxoplasmosis
    112319176 (IFNG)
   05140 Leishmaniasis
    112319176 (IFNG)
   05142 Chagas disease
    112319176 (IFNG)
   05143 African trypanosomiasis
    112319176 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dro03051]
    112319176 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112319176 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112319176 (IFNG)
Proteasome [BR:dro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112319176 (IFNG)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Interferons
   112319176 (IFNG)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Haparin
  Cytokines
   112319176 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 DUF3336 PRANC
Other DBs
NCBI-GeneID: 112319176
NCBI-ProteinID: XP_024432249
Position
Unknown
AA seq 166 aa
MKYTSYILAFQLCVILGSSSYLCQATSIKEIENLKEYFNASKSDVADNETLFSNVFKKWK
EESDRKIFQSQIVSFYFKLFDSLKDNQNIQSSVEVIKEDLRVKFFNSSTSKMEDFTKLIQ
IPVNDLKVQRKAINELIRVMKELAPGSTLRKRRRSPKLFHARSASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatacacaagttacatcttagcttttcagctttgcgtgattttgggttcttccagc
tacctctgccaggcgacatctattaaagaaatagaaaaccttaaagaatattttaatgca
agtaagtcagatgtagcagataacgagactctcttctcaaatgttttcaagaagtggaaa
gaggagagtgacagaaaaatatttcagagccaaattgtctccttctacttcaaactcttt
gactccttaaaagacaaccagaacattcaaagcagcgtggaagtgatcaaggaggacctg
cgtgtcaagttcttcaacagcagcaccagcaaaatggaggacttcacgaagctgattcaa
attccggtaaatgatctgaaggtccagcgcaaagcaataaatgaactcatcagggtgatg
aaggagctggcaccaggatctaccctgaggaagcgcagaaggagtcccaagctgtttcat
gcccggagtgcctcaaaataa

DBGET integrated database retrieval system