KEGG   Desmodus rotundus (common vampire bat): 112319624Help
Entry
112319624         CDS       T05907                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04020  Calcium signaling pathway
dro04024  cAMP signaling pathway
dro04080  Neuroactive ligand-receptor interaction
dro04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    112319624 (HTR4)
   04024 cAMP signaling pathway
    112319624 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112319624 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    112319624 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dro04030]
    112319624 (HTR4)
G protein-coupled receptors [BR:dro04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    112319624 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 112319624
NCBI-ProteinID: XP_024432739
Position
Unknown
AA seq 388 aa AA seqDB search
MDELDANVSSKEGFRSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIIDLIEKRKFHHSSN
STYCIFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGAPSEGRP
QPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQSHPPATSPLVAAQPCDT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacttgatgctaatgtgagttccaaggagggtttcaggtcagtggagaaggtc
gtgctgctcacgtttctctcagcggtgatcctgatggccatcttgggcaaccttctggtg
atggtggctgtgtgcagggaccggcagctcaggaaaataaaaaccaactatttcattgtc
tctcttgcctttgcggatttgctggtgtccgtgctggtgatgcccttcggtgccattgag
ctggtccaggacatctggatttacggggagatgttttgcctcgtccggacatctctagac
gtcctgctcacaacagcatccatttttcacctgtgctgcatttctctggacaggtactat
gccatctgctgccagcccttggtctataggaacaagatgacccccctgcgcatcgcatta
atgctgggaggctgctgggtcatccccatgtttatctcttttcttcctataatgcaaggc
tggaataacatcggcataattgatttgatagaaaaaagaaagttccaccacagctccaac
tctacatactgtatcttcatggtcaacaagccctacgccatcacctgctctgtggtggcc
ttctacatcccgtttctgctcatggtgctggcctattaccgcatctatgtcacagccaag
gagcacgcccaccagatccagatgttacagcgtgctggagcaccctcggagggcaggcca
cagccggcagaccagcacagcactcatcgcatgaggacagagaccaaagcagctaagacc
ctgtgcatcatcatgggttgcttctgcctctgctgggccccattctttgtcaccaatatc
gtggatccgttcatagactacactgtccctgggcaggtgtggactgctttcctctggctc
ggctatatcaattctggattgaacccctttctctacgccttcttgaataagtcttttcga
cgtgcctttctcatcatcctctgctgtgatgatgaacgctaccgaagaccttccattctg
ggacagacggtcccctgttcaaccacaaccattaatgggtcaacacatgtgctaagggat
gcagtggagtgtggtggccaatgggagagtcagagccaccctccagcaacttctcctttg
gtggctgctcagccctgtgacacttag

DBGET integrated database retrieval system