KEGG   Desmodus rotundus (common vampire bat): 112319699
Entry
112319699         CDS       T05907                                 

Gene name
CARD11
Definition
(RefSeq) caspase recruitment domain-containing protein 11
  KO
K07367  caspase recruitment domain-containing protein 11
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04064  NF-kappa B signaling pathway
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112319699 (CARD11)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    112319699 (CARD11)
   04662 B cell receptor signaling pathway
    112319699 (CARD11)
SSDB
Motif
Pfam: CARD Guanylate_kin PDZ
Other DBs
NCBI-GeneID: 112319699
NCBI-ProteinID: XP_024432840
Position
Unknown
AA seq 1147 aa
MDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPTLP
SKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVEEGHEGL
THFLMNEVIKLQQQMKAKDLQRCELLAKSRQLEDEKKQLTLTQVELLTFQDRYYKMKEER
DSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVIRSRDLQLEIDQLKHRLNKMEEECKLER
NQSLKLKNDIENRPKKEQVLELERENEMLKTKIQELQSIIQAGKRSLPDSDKAILDILEH
DRKEALEDRQELVNKIYNLQEEVRQAEELRDKYLEEREDLELKCSTLGKDCEMYKHRMNT
VMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIREQEEKIDEMRIEMVRREAC
IVNLESKLRRLSRDSGSLEQSLPRNLPVTIIAQNFGDAGPRTNGQEADDSSTSEDSPEDS
RYFLPYHPPKRRMNLKGIQLQRAKSPISLKRASDFQGRGQEEEGTDASPSSSRSLPITNS
LPKLQPHRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSAVEEDNDSVGFDALDLDDDSHE
RYSFGPPSVHSSSSSHQSESLDAYELEQVNLMLRKFSLERPFRPSVTSVGHVRGPGPSVQ
HATLSGDSLTSQLTLLGGNARGSFVHWVKPGSQAERAGLHQGLQLLLLEGCIKGEKQSVP
LDTCTKEEAHWTIQRCSGPVTLHYKVNQEGYRKLLKDLEDGLITSGDSFYIRLNLNISSQ
LDACSMSLKCDDVVHIRDTMYQDKHEWLCARVDPFTDHDLDVGTIPSYSRAQQLLLVKLQ
RLMHRGSREEADTAHHTLRALRNTLQPEEPLSTSDPRVSPRLSRASFFFGQLLQFVSRSE
NKYKRMNSNERVRIVPGSPRGGLARPSLDATKLLTDRQEELDPESELSKNFSLIPYSLVR
AVHCERRRPVLFTPTMLAKALVQKLLNSGGALELTMCKPDVVTRDEFLRKQKSQTIIYSR
EKNPNTFECIVPAHIEAVAAKNKHCLLEAGIGCARELIKSRIYPIVLFIRVSEKNIKKFR
KMLPRPETEEEFLRLCRLREKELEALPCLYATVETDMWGSVEELLRVVKDKIGEEQRKTV
WVDEDQL
NT seq 3444 nt   +upstreamnt  +downstreamnt
atggacgactacatggagacgctgaaggacgaggaggatgcgctgtgggagaacgtggag
tgcaaccggcacatgctgagccgctacatcaaccccgccaagctcaccccctacctgcgc
cagtgcaaggtcatcgacgagcaggacgaggacgaagtgctcaacgcccccacgctgccg
tccaagatcaaccgggcaggccgactgctggacatcctgcacaccaagggccaaaggggc
tacgtggtcttcctggagagcctggagttctattacccagaactgtacaagctggtgacc
gggaaggagcccacccggaggttctccaccattgtggtggaggagggccacgagggcctc
acgcacttcctcatgaacgaggtcatcaagctgcagcagcagatgaaagccaaggaccta
cagcgctgcgagctcctggccaagtcccggcagctagaggacgagaagaagcagctgacg
ctgacacaggtggagctgctgaccttccaggaccggtactacaagatgaaggaggagcgc
gacagctacaacgacgagctggtcaaggtgaaggacgacaactacaacctggccatgcgc
tacgcccagctcagcgaagagaagaacatggcggtcattcggagccgagacctgcaactg
gagatcgaccagctgaagcaccgactgaacaagatggaggaggagtgcaagctggagagg
aaccagtccctgaagctgaagaacgacatcgagaaccggcccaagaaggagcaggtgcta
gagctggagcgggagaacgagatgctgaagaccaagatccaggagctgcagtcaatcata
caggccgggaagcgcagcctgccagactcggacaaggccatcctggacatcctggagcac
gaccgcaaggaggccctggaggaccggcaggagctcgtcaacaagatctacaacctgcag
gaggaggtccgccaggcggaggagctgcgcgacaagtacctggaggagagggaagacctg
gagctgaagtgctcgaccctggggaaggactgcgagatgtacaagcaccgcatgaacacg
gtcatgctgcagctggaggaggtggagcgggagcgcgaccaggccttccactcccgggat
gaagcgcaaacacagtactcccagtgcctgatcgaaaaggacaagtacaggaagcagatc
cgcgagcaggaggagaagatcgacgagatgaggatcgagatggtccgccgggaagcctgc
atcgtcaacctggagagcaagctccggcgcctgtccagggacagtggcagcctggagcag
agcctgcccaggaacctgccggtgaccatcatcgctcagaactttggggacgccggcccc
cggaccaacggtcaggaagccgacgactcttccacctcagaggactcgccggaagacagc
agatacttcctgccctaccacccccccaagcgcaggatgaatctgaagggcatccagctg
cagagagccaagtcccccatcagcctgaagcgagcatcagattttcaagggaggggtcag
gaggaagaaggcacggatgccagccccagctcctcccgatccctgcccatcaccaactcc
ttacccaagcttcagccccaccggagccggtccagcatcatgtccatcaccgccgagccc
ccaggaaacgactccatcgtccggcgctacaaggaagatgcgcctcaccggagcgctgtg
gaagaagacaacgacagtgttggattcgatgccttagaccttgatgacgacagtcacgag
cggtactcctttggccccccctctgtccactcctcctcctcctcccaccagtccgagagc
ctggatgcctacgagctggagcaggtcaacctcatgctcaggaagttctctctagaaaga
cccttccgaccgtccgtcacctctgtggggcacgtgcgtggccccgggccctcggtgcag
cacgccacgctgagcggcgacagcctcacctcccagctcaccctgctcgggggcaacgcg
cggggcagcttcgtgcactgggtcaaaccgggctcgcaagcggagagagcgggcctgcac
cagggcctgcagctgctgctgctggaaggctgcatcaaaggtgagaagcagagtgtcccc
ttggacacgtgcacgaaggaggaggcacactggaccatccagaggtgcagcggccccgtc
acactgcactacaaagtcaaccaggaagggtaccggaagctgctgaaggacttggaggac
ggcctcatcacctccggcgactccttctacatccggctgaacctgaacatctccagccag
ctggacgcctgctccatgtccctgaagtgcgacgacgtcgtgcacattcgggacaccatg
taccaggacaagcacgagtggctgtgtgcgcgggtcgaccccttcacggaccacgacctg
gacgtgggcaccatacccagctacagccgagcccagcagctcctcctggtcaagctgcag
cgtctgatgcacaggggcagccgggaggaggcggacaccgcccaccacaccctgcgggca
ctccggaacactctgcagcccgaagaaccactctccaccagtgacccgcgggtcagcccc
cgcctctcgagagcaagcttcttcttcggccagctccttcagttcgtcagcaggtcagag
aacaagtacaagaggatgaacagcaatgagcgggtacgcatcgtgccggggagcccgcgg
gggggcctggcccggccctcgctggacgccaccaagctcttgaccgacaggcaggaagag
ctggaccctgagagcgaactcagcaagaacttcagcctgatcccctacagcctggtgcgc
gccgtccactgcgagcgccgccggcccgtgctcttcacgcccaccatgctggccaaggcg
ctggtccaaaagctgctcaactcaggcggcgcgctggagctcaccatgtgcaagcccgat
gtcgtcacgagagacgagttcctccggaagcagaagtcgcagaccatcatctactcccgg
gagaagaaccccaacaccttcgagtgcatcgtgcccgcccacatcgaggctgtggcagcc
aagaacaaacactgcctgctggaggccgggatcggctgcgcccgggagctgatcaagtcc
aggatctaccccatcgtgctattcatccgggtgtcggagaagaacatcaagaagttcagg
aagatgctgccgcggccggagaccgaggaggagttcctgcgcctgtgccggctcagagag
aaggagctggaggccctgccgtgcctgtacgccaccgtggagaccgacatgtggggcagc
gtggaggagctgctccgcgtcgtcaaagacaagatcggcgaggagcagcgcaagaccgtc
tgggtggacgaggaccagctgtga

DBGET integrated database retrieval system