KEGG   Desmodus rotundus (common vampire bat): 112319868
Entry
112319868         CDS       T05907                                 

Gene name
AHR
Definition
(RefSeq) aryl hydrocarbon receptor
  KO
K09093  aryl hydrocarbon receptor
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04659  Th17 cell differentiation
dro04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112319868 (AHR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112319868 (AHR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112319868 (AHR)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112319868 (AHR)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_4 PAS_9
Other DBs
NCBI-GeneID: 112319868
NCBI-ProteinID: XP_024433027
Position
Unknown
AA seq 857 aa
MNGGSANITYASRKRRKPVQKTIKPIPPEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPADRSGVQDNCGTKFGDGLNFHEGEFLLQA
LNGFVLVVTTDAVVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPS
QCTDSGQRVDEANGLPQPAVYPNPDQLPPENSMLMERCFVCRLRCLLDNSSGFLAMNFQG
RLKYLHGQNKKAKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPTGVD
AKGKLILGYTEAELCMRGSGYQFIHAADMLYCAEYHIRMIKTGESGMVVFRLLTKDNQWT
WVQSNARLVYKNGRPDYIIATQRPLTDEEGTEHLRKRNMKLPFMFATGEAVLYEISNPFP
PIMDTLPVRPQNIASGQDSVTESTPHKDSLWTALMQQDKSIYLSHAASSTPLDRDIFNEY
MNECGNWQDSIAPMGNGILKHEQIGQPQEVNMAFSEGPAGLFPDNKNSDLYSIMKRLGVD
FEDIKHMQQHEEFFRTDFSGEDDFRDIDITDEILTFVQDSLDKSTFVCPGYQQQPPTVLS
SSCMVQEHLQLEQQQQQQQQQLLLQPHRKHPAMEQQQQQQQQQQQLCQKMKHMQVNGMFA
NWSSNQSVPFSCPQQDQQQYAVFSDLPGPSQEFPYKSEVETMPYTQNFIPCNQSVLQQQS
QGTQLDFPIGNFEPSPYPTTTSNLEDFVTCLQVSENQKHRLHPQSSLMTPQTCYSGAVSM
YPCQPEPQQRHVAQMECNPTVPGPQAFLTKFQNGVLNDIYPAELSATDNTQTAAHVQSLH
HLSEAGPFADLTSSRFL
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgaacggcggcagcgccaacatcacctacgcaagtcgcaagcggcggaaacccgtgcag
aaaaccatcaagccaatcccgcctgaaggaatcaagtcgaatccttccaagcgacacaga
gaccgactcaatactgagctggaccgtttggcgagcctgctgccttttccacaagatgtt
attaataagctggacaaactttccgttcttaggctcagtgtcagttacctaagagccaag
agcttctttgatgttgcattaaaatcctccccagccgacaggagtggagtccaggataac
tgtggaacgaaatttggggatggtctgaactttcatgaaggagaattcttattacaggcc
ctgaacggctttgtgctggtcgtcacgacggatgccgtggtcttctatgcttcttctact
atacaagattatctggggtttcagcagtccgatgtcatacatcagagtgtgtatgaactg
atccacactgaagaccgagctgaatttcagcgtcagctgcactgggcattaaacccttca
cagtgcacagactctggacaaagagtcgatgaagctaatggcctcccacagccggcagtc
taccctaacccagaccagctccccccagaaaactccatgctcatggagaggtgcttcgta
tgccgcctgcggtgcctgctggacaactcctccggttttctggcaatgaatttccaaggg
aggttaaagtatcttcacggccagaacaagaaagcgaaagatggatcaatccttccgcct
cagttagctctgtttgccatagctactccacttcagccgccatctatacttgaaatccga
accaaaaacttcatctttagaacaaagcacaaattagactttacgcctactggtgttgat
gccaaagggaaacttattttaggctatactgaagcagagctgtgcatgagagggtccggg
tatcagtttatccatgctgccgacatgctttactgtgccgagtaccacatccggatgatt
aagaccggagagagtggcatggtggtgttcaggctgctcaccaaagacaatcagtggacc
tgggtccagtctaacgcacgcctggtgtacaaaaatgggaggcccgactacatcattgcg
acccagaggccactgacagatgaagaaggaacagagcatctaagaaaacgaaatatgaag
ttgccttttatgtttgccactggagaagctgtgttgtatgagataagtaacccctttcct
cccataatggataccttaccagtaaggcctcaaaatattgctagtgggcaggattctgtt
accgaatcaactccacataaggattctctctggactgcccttatgcagcaagataagtct
atttatctctctcatgcggcaagtagcacacctttggacagagatatttttaatgaatat
atgaacgaatgtggtaattggcaagacagtattgcaccgatgggaaatggtatcctgaaa
cacgagcaaatcggtcagcctcaggaagtgaacatggcattctctgaaggtccagcaggg
ctcttcccagacaataaaaatagtgacttgtacagcattatgaaacgcctaggtgttgat
tttgaagatattaaacacatgcagcagcatgaggaatttttcagaactgacttttccggt
gaggatgacttccgagacattgacataacggatgagatcctgacgtttgtccaagattct
ttagataagtctaccttcgtgtgtccaggctaccagcagcaaccacccacagtgctgagc
tcgagctgcatggtccaggagcatctgcagttagagcagcagcagcagcagcagcagcag
cagctgctactacagccccatcgaaagcaccccgccatggagcagcagcagcagcagcag
cagcagcagcagcagctgtgccagaaaatgaagcacatgcaagtcaacggcatgtttgcg
aattggagctctaaccagtccgtgccttttagttgtcctcagcaagaccaacaacagtat
gctgtcttttcagacttacctggccccagtcaagagttcccctacaaatccgaggttgag
acgatgccttacacacagaactttattccctgtaaccagtctgtgttacagcagcagtcg
caggggacccagttggactttcccatagggaattttgaaccatccccataccctactact
acttctaatttagaagattttgtcacatgtttacaagtttctgaaaaccaaaagcacaga
ctacatccacagtcaagcctaatgactccacagacgtgctattccggggccgtgtcaatg
tacccgtgtcagccggagcctcagcaacgccatgtggcccagatggagtgcaacccaacc
gtgccaggcccacaggcatttctaaccaagtttcagaatggagttttaaatgacatctat
ccagctgaattaagtgctacagataacactcagacggccgcacatgtccagtccctccat
catctgtcagaagccggacctttcgctgacttgacatctagtagattcctataa

DBGET integrated database retrieval system