KEGG   Desmodus rotundus (common vampire bat): 112320195
Entry
112320195         CDS       T05907                                 

Gene name
CD79A
Definition
(RefSeq) B-cell antigen receptor complex-associated protein alpha chain
  KO
K06506  CD79A antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04662  B cell receptor signaling pathway
dro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112320195 (CD79A)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    112320195 (CD79A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dro04090]
    112320195 (CD79A)
CD molecules [BR:dro04090]
 Proteins
  112320195 (CD79A)
SSDB
Motif
Pfam: ig Ig_3 V-set I-set ITAM Ig_6 Ig_2 Ig_4
Other DBs
NCBI-GeneID: 112320195
NCBI-ProteinID: XP_024433431
Position
Unknown
AA seq 230 aa
MPGGPGVLQPPPGTIFLLLICAAGLGPGGQTLWVSSGPPSVTVNVGEEARLQCLYNSSRR
DCTVKWWRVLQGNYTWPPQYQGLGKGPSSELTFPSAMKNDSGLYLCEVTENTTATTVKVR
RSCGTYLRVREPTPRPFLDMGEGTKNNIITAEGIILLFCAVVPGTLLLFRKRWQNMKFGV
DAQDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLHIGDVQLEKP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcctgggggtcccggagtcctgcaacccccgcctgggacgatcttcctcctcttgatc
tgcgctgctggcctgggcccagggggccagaccctgtgggtgagctcaggcccgccatcg
gtgacggtgaatgtgggggaggaggcccgcctccagtgcctgtacaacagcagccgcagg
gactgtacggtcaagtggtggcgagtcctccaaggcaactacacgtggccccctcagtac
caaggccttggcaagggcccctccagtgagctgaccttcccatcagcaatgaagaatgac
tcaggcctatacctgtgcgaagtcacagaaaacaccaccgccaccacggtgaaggtccgg
cgctcctgtggcacctatctccgcgtgcgtgagccgacccccaggcccttcctggacatg
ggggagggcactaagaacaacatcatcacagccgaggggatcatcctgctgttctgcgct
gtggtgcctgggacactgctgctgttcaggaaacgatggcagaatatgaagttcggagtg
gatgcccaggatgactatgaagatgaaaatctttatgagggcctgaaccttgatgactgc
tccatgtacgaggacatctcccggggcctccagggcacctaccaggacgtgggcagcctc
cacatcggagatgtacagctggagaagccgtga

DBGET integrated database retrieval system