KEGG   Desmodus rotundus (common vampire bat): 112320238
Entry
112320238         CDS       T05907                                 

Gene name
CD22
Definition
(RefSeq) B-cell receptor CD22 isoform X1
  KO
K06467  CD22 antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04514  Cell adhesion molecules
dro04640  Hematopoietic cell lineage
dro04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112320238 (CD22)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112320238 (CD22)
   04662 B cell receptor signaling pathway
    112320238 (CD22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dro04090]
    112320238 (CD22)
   04091 Lectins [BR:dro04091]
    112320238 (CD22)
CD molecules [BR:dro04090]
 Proteins
  112320238 (CD22)
Lectins [BR:dro04091]
 I-type lectins (Siglecs)
  112320238 (CD22)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig I-set V-set Ig_4 C2-set_2 Ig_6 C1-set Ig_C17orf99 Izumo-Ig V-set_CD47 Adeno_E3_CR1
Other DBs
NCBI-GeneID: 112320238
NCBI-ProteinID: XP_024433484
Position
Unknown
AA seq 852 aa
MHLLSPLLLLLEHLAFSDSQDWKFEHPETFYAWEGTCIWIPCRYTIPGNGKVLDNLTVYQ
NYEWDSITKNFNGAILYEEKKFETSASKGRVQFLGDNKSNCTLHIHPVNAQDNGHLGLRV
TSGNDKWMDKIVLNISKTAPPPRIDLPLEIRELQEATVTCKLDFACFGYQIKLQWSLEGT
QHNLSSVPSSILTTKTVSTQSQLTFQPVWTNHGKKLTCQLWNDSADGLLSQETVRLDVKH
SPKLQITPGEAIVKKGDSVTMKCQIISSNPQYKTMSWFKDGNHLSEQETLHREQKTVTLT
LSSVTKQMTGNYHCEAQNDIGSTKLEVTLQVHYAPEPSTVEFTVLPAKEGSKISLTCTSQ
AYPPPISYTWYHNKIEIPTTNKTFQIPKVLLKHAGNYSCLAKNSVGPGEIGQAAELDVQY
SPKNVTMVIQNPTPIREGDNVTLFCNYTSSNPRVTSYEWQSQGFRKEIMPGVMMIQKVPW
NASQFSCAACNQWCSWAVPVNLHVQYAPRGVNVLPISPGSEIHSGHPVLLRCNFSSSYPT
DVLFFWKKNGIFLKEGRDLSFNPISPEDTGNYNCLVNNSIGQSTSEAWKLQVLYAPRRLR
VSISPEDSVMEGKKAVLTCESDANPPISQYTWFDWNNQNLHHDDQTLRLDPVKVQHSGAY
WCQGANRLGMDQSPPRILTVYYSPETISRQVALGMGLFLAILLLPLLGVKLQRSWKRIQS
QQELQENSSAQSFFVRNRKVRRAPLSEGPHSLGCYNPVMEDSISYATLRFPVAEADTPRI
GEAGTSEVQRTSSNRDNTVTYSVVQKHQVGDYENVTPDVPEDEGIHYSELVHLGLGERPL
SQEGVEYVTLKH
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgcatctcctcagccccttgctcctgctcctcgaacacttggctttctctgactcacaa
gattggaagtttgaacacccggaaaccttctacgcctgggaggggacctgcatctggatt
ccctgccgctacacaatcccggggaatggaaaagtcctggataacctgactgtgtatcag
aattatgagtgggacagcataaccaagaatttcaatggggcaatcctctatgaagagaaa
aagtttgagacatccgcctctaagggaagggtacaattcctgggagacaacaaatccaac
tgcaccctccacattcaccctgtaaatgcccaagacaatggtcatctggggctgagggtg
acatcggggaatgacaaatggatggacaagatagtcctcaacatctccaagacagctcct
ccacctcgcattgacctccctctagagatccgggagctccaggaggccacagtgacatgc
aaactggattttgcctgctttgggtaccagatcaaattgcagtggtccctggaggggaca
caacacaatctttcctctgtcccttcaagtatcctgaccaccaagactgtctctacccag
agccagctcacattccagccagtgtggaccaaccatggcaagaaactgacctgtcagctc
tggaatgatagtgcagatgggctactctctcaggaaacagtgcggctagatgtgaagcac
tccccaaaattgcagatcactcctggagaagccattgtgaaaaagggggattctgtgacc
atgaagtgccagatcatcagcagcaacccacagtacaagactatgtcctggttcaaggat
ggaaaccatttgagtgagcaggagacactgcacagggagcagaagacagtcacactaact
ctgtcctcagtgaccaagcagatgactggaaactaccactgtgaggcccagaatgatata
ggctcaacaaagttagaagtgaccctccaagtgcactatgctccagaaccttccacggtt
gagttcacagtcttaccagctaaggagggaagtaaaataagcctgacttgtacatcacag
gcctatcctcctccaataagttatacctggtatcataataagattgaaataccgacaaca
aacaagaccttccagatcccaaaggtcctcctcaagcatgctgggaattattcctgcttg
gcaaaaaacagtgttggtccaggagaaattggccaagcagctgagttggatgtccaatat
tcccctaaaaatgtaaccatggtgattcaaaaccccacaccaattcgagaaggagacaat
gtgaccctgttttgcaactacacttccagtaacccccgtgttaccagttatgaatggcaa
tcccaaggcttccggaaagagataatgcctggggtgatgatgattcagaaagttccctgg
aatgccagtcaattctcctgtgcagcctgtaaccagtggtgttcatgggctgtccctgtc
aacctacatgtccagtatgcccccagaggtgtcaacgttcttccgatcagccctggctct
gagattcactctgggcacccagtcctcctccgatgtaacttctcaagtagctacccaact
gatgttctcttcttctggaagaaaaatggaatatttctgaaggaaggaagagatctgagc
tttaaccccatctctccagaagatactggaaattacaactgcttggtcaacaactccata
ggacagagcacgtctgaggcctggaagctccaagtgctgtatgcacctaggaggctacga
gtgtccattagccctgaagacagtgtgatggaggggaagaaggcagtcctgacatgtgag
agtgatgccaaccctcccatctcccagtacacctggtttgactggaataaccaaaacctt
caccatgatgatcagacactgagattggatcctgtgaaggtccagcactcaggcgcctat
tggtgccagggggccaaccgactgggcatggaccagtcaccccccagaatcctcactgtc
tactatagtccagagaccatcagcaggcaagtggctctgggaatggggctcttcctggcc
atcctcctcctgccactcttgggggtgaagcttcagcgaagctggaagaggattcagagc
caacaagagcttcaggaaaactccagtgcacagagcttctttgtgaggaacagaaaggtt
agaagagccccgctctccgaaggcccccactccctgggctgctacaacccagtgatggaa
gattccatcagctatgctactctgcgctttcctgttgctgaggctgacacaccaaggatt
ggagaggcaggaacctcagaggtgcagagaacttcctcaaacagggacaacacggtcact
tactctgtggtgcagaagcatcaagtgggcgactatgagaatgtgactccagatgttcca
gaagacgaagggatacattactcggagctggttcatttggggcttggcgagcggcctctg
agtcaagaaggagtggaatatgtgaccctcaagcactaa

DBGET integrated database retrieval system