KEGG   Desmodus rotundus (common vampire bat): 112320475
Entry
112320475         CDS       T05907                                 

Gene name
CD80
Definition
(RefSeq) T-lymphocyte activation antigen CD80
  KO
K05412  CD80 antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04514  Cell adhesion molecules
dro04620  Toll-like receptor signaling pathway
dro04672  Intestinal immune network for IgA production
dro04940  Type I diabetes mellitus
dro05320  Autoimmune thyroid disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112320475 (CD80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112320475 (CD80)
   04672 Intestinal immune network for IgA production
    112320475 (CD80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    112320475 (CD80)
   05323 Rheumatoid arthritis
    112320475 (CD80)
   05320 Autoimmune thyroid disease
    112320475 (CD80)
   05330 Allograft rejection
    112320475 (CD80)
   05332 Graft-versus-host disease
    112320475 (CD80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112320475 (CD80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112320475 (CD80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dro04090]
    112320475 (CD80)
CD molecules [BR:dro04090]
 Proteins
  112320475 (CD80)
SSDB
Motif
Pfam: C2-set_2 V-set Ig_3 ig I-set Izumo-Ig
Other DBs
NCBI-GeneID: 112320475
NCBI-ProteinID: XP_024433686
Position
Unknown
AA seq 310 aa
MGQKAMLTWGTLPPKCSYLKLFQLLVLAGLFYFCSGISQVIKRVKDTAVLPCDYNVSTDD
LTRVRIYWQKKENSDVVLSVIYGKVKVWPKYRNRTIHTITNNPSIVILALQLSDEGIYDC
IIQKLEKGGYQMVHSKSVRLLVRADFPVPSITELGNPSTNIKRIVCSTSGGFPKPHLFWL
ENGKKLNAINTTVSQDPESELYTISSELGFNVTNNHSFMCLVKYGNSTVSQIFNWQKYDP
STPPFIHLSWIWTIAMVFGFALCAILREVILRYQPNSRCAARTCCKRRNEESIEMERISP
IYSRPAKASE
NT seq 933 nt   +upstreamnt  +downstreamnt
atgggtcaaaaagccatgctaacgtggggaacactaccacccaagtgctcatacctcaag
ctctttcagcttctggtgctggctggtcttttttacttctgttcaggcatcagccaggtg
attaagagagtgaaagatacagcagtactaccttgtgattacaacgtctccactgatgac
ctgacaagagttcgcatctactggcaaaaaaaagaaaatagtgatgtggtgctgagtgtc
atatatggaaaagtgaaagtgtggcccaagtacaggaaccgcaccatccacaccatcacc
aataacccttccatcgtgatcctggctctgcaactgtcggacgaaggcatctacgactgc
atcattcagaaacttgaaaaaggaggctaccagatggtacattcgaagtcggtgagatta
ttggtcagagctgacttccctgtcccaagtataactgagcttggaaatccatctactaac
atcaaaaggatagtttgctcaacctctggaggttttccaaagcctcacctcttctggttg
gaaaatggaaaaaaattaaatgccatcaacacaacagtttcccaagatcctgaaagtgag
ctctacactattagcagtgaactgggtttcaatgtgacaaacaaccacagcttcatgtgt
ctggtcaagtatggaaactcaacagtgtcacaaatcttcaactggcaaaaatatgatcca
tctacccctccttttattcatctgtcctggatttggaccattgcaatggtatttgggttt
gctctctgtgctattctccgtgaagtaatcctaagataccaacccaacagtagatgtgct
gcaaggacgtgctgcaagaggaggaatgaggagagcatagaaatggaaaggatctcgcct
atctactctagacctgcaaaagcatcagaatga

KEGG   Desmodus rotundus (common vampire bat): 112320646
Entry
112320646         CDS       T05907                                 

Gene name
CD86
Definition
(RefSeq) T-lymphocyte activation antigen CD86
  KO
K05413  CD86 antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04514  Cell adhesion molecules
dro04620  Toll-like receptor signaling pathway
dro04672  Intestinal immune network for IgA production
dro04940  Type I diabetes mellitus
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05202  Transcriptional misregulation in cancer
dro05320  Autoimmune thyroid disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112320646 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112320646 (CD86)
   04672 Intestinal immune network for IgA production
    112320646 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    112320646 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    112320646 (CD86)
   05323 Rheumatoid arthritis
    112320646 (CD86)
   05320 Autoimmune thyroid disease
    112320646 (CD86)
   05330 Allograft rejection
    112320646 (CD86)
   05332 Graft-versus-host disease
    112320646 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112320646 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112320646 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    112320646 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112320646 (CD86)
   04090 CD molecules [BR:dro04090]
    112320646 (CD86)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112320646 (CD86)
CD molecules [BR:dro04090]
 Proteins
  112320646 (CD86)
SSDB
Motif
Pfam: V-set Ig_3 I-set C2-set_2 Ig_2 Lep_receptor_Ig Insulin_TMD
Other DBs
NCBI-GeneID: 112320646
NCBI-ProteinID: XP_024433924
Position
Unknown
AA seq 335 aa
MDLGCTMGLSTTLFVMAFLLFGVASMKNQAYFNETGYLPCHFTNSQNISLGELVVFWQNQ
DKLVLYEFYRGKENPENVDPDYKGRTSLDKDNWTLRLHNVQIKDKGLYQCFVHRKGTSGL
VPIHQMSTDLSVRANFSQPKIMATSNSTGNSDITNLTCSSARGYPEPKKMFFWLTTVNAT
TKYDAVMNIFQNNITGLYNVSISLSFPISPGSNVSIFCVLQPGPTQTQLVSESYIIGKPP
KPAPPEQDPAIVVTASVLTLLVIFLCGVGFCVTLKKRKKQQPGPAREREAMKVEGEESKQ
MEERVENRVPERSDEAQCVVNILKTASGDRSAAHF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggatcttggatgcactatgggactgagtaccactctctttgtgatggccttcctgctc
tttggtgttgcttccatgaagaatcaggcgtatttcaatgagactggatatcttccctgc
cactttaccaactctcaaaacataagcctgggtgagctggtagtattttggcagaaccag
gataagttggttctgtatgaattctacagaggcaaagaaaatcctgagaatgttgatcca
gattacaagggccgcacaagcttggacaaggataattggaccctgagactccacaatgtt
cagatcaaggacaagggcttgtatcagtgtttcgtccatcgcaaagggaccagtggattg
gttcccatccaccaaatgagtactgacctgtcagtgcgtgctaacttcagtcaacctaaa
ataatggcaacttctaacagtacaggaaattctgacatcacaaatttgacctgctcatct
gcacgaggttacccagaacctaagaagatgtttttttggctaacaaccgtgaatgcaact
actaagtatgatgctgtcatgaatatatttcaaaataatatcacaggattatacaatgtt
tctatcagcttgtcttttccaatatctcctggatcgaacgtgagcatcttctgtgtcctg
caacctgggccaacacagacacagcttgtctccgaatcttacattataggtaaaccacca
aagccagccccacctgaacaagaccctgccatcgttgtgactgcgtctgtacttacacta
ttggtcatctttctgtgtggggtggggttctgtgtaacactaaagaaaaggaagaagcag
cagcctggccccgctcgtgaacgtgaagccatgaaagtggaaggggaagagagtaaacag
atggaggaaagagtagaaaaccgtgtacctgaaagatctgatgaagcccagtgtgttgtt
aacattttgaagacggcctcaggtgacagaagtgccgcacacttttga

DBGET integrated database retrieval system