KEGG   Desmodus rotundus (common vampire bat): 112320540
Entry
112320540         CDS       T05907                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro04012  ErbB signaling pathway
dro04062  Chemokine signaling pathway
dro04110  Cell cycle
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04310  Wnt signaling pathway
dro04340  Hedgehog signaling pathway
dro04360  Axon guidance
dro04390  Hippo signaling pathway
dro04510  Focal adhesion
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04657  IL-17 signaling pathway
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04722  Neurotrophin signaling pathway
dro04728  Dopaminergic synapse
dro04910  Insulin signaling pathway
dro04916  Melanogenesis
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro05010  Alzheimer disease
dro05020  Prion disease
dro05135  Yersinia infection
dro05160  Hepatitis C
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05213  Endometrial cancer
dro05215  Prostate cancer
dro05217  Basal cell carcinoma
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112320540 (GSK3B)
   04310 Wnt signaling pathway
    112320540 (GSK3B)
   04340 Hedgehog signaling pathway
    112320540 (GSK3B)
   04390 Hippo signaling pathway
    112320540 (GSK3B)
   04151 PI3K-Akt signaling pathway
    112320540 (GSK3B)
   04150 mTOR signaling pathway
    112320540 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112320540 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112320540 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    112320540 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    112320540 (GSK3B)
   04657 IL-17 signaling pathway
    112320540 (GSK3B)
   04662 B cell receptor signaling pathway
    112320540 (GSK3B)
   04062 Chemokine signaling pathway
    112320540 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112320540 (GSK3B)
   04917 Prolactin signaling pathway
    112320540 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    112320540 (GSK3B)
   04919 Thyroid hormone signaling pathway
    112320540 (GSK3B)
   04916 Melanogenesis
    112320540 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    112320540 (GSK3B)
   04722 Neurotrophin signaling pathway
    112320540 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    112320540 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112320540 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112320540 (GSK3B)
   05225 Hepatocellular carcinoma
    112320540 (GSK3B)
   05226 Gastric cancer
    112320540 (GSK3B)
   05217 Basal cell carcinoma
    112320540 (GSK3B)
   05215 Prostate cancer
    112320540 (GSK3B)
   05213 Endometrial cancer
    112320540 (GSK3B)
   05224 Breast cancer
    112320540 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112320540 (GSK3B)
   05020 Prion disease
    112320540 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112320540 (GSK3B)
   04931 Insulin resistance
    112320540 (GSK3B)
   04934 Cushing syndrome
    112320540 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112320540 (GSK3B)
  09172 Infectious disease: viral
   05162 Measles
    112320540 (GSK3B)
   05160 Hepatitis C
    112320540 (GSK3B)
   05163 Human cytomegalovirus infection
    112320540 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112320540 (GSK3B)
   05165 Human papillomavirus infection
    112320540 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112320540 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112320540 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dro03036]
    112320540 (GSK3B)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     112320540 (GSK3B)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   112320540 (GSK3B)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112320540 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 112320540
NCBI-ProteinID: XP_024433788
Position
Unknown
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRVQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcttttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagtaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatgggtcatttggtgtggtatatcaagccaaactttgtgattcgggagaa
ctggttgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgcttcctgtgatctatgtcaagttg
tatatgtatcagctgtttcgaagtttagcctatattcattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggaccctgatacggctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgcaggctgtgtgctggctgagctattgctaggacaaccaatatttccaggggac
agtggtgtggatcagttggtagaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaacccaaactatacagaatttaaatttcctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cgaactccaccagaggcaattgcactgtgtagccgtctgcttgagtatacaccaactgcc
cgattgacgccactggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctacaatccttattcctcctcatgctcggattcaagcagct
gcttcaacccctacaaatgccacagcagcctcagatgctaatgctggagaccgtgtacag
accaataatgccgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system